1VX7,3ZF7


Conserved Protein Domain Family
Ribosomal_L5e

?
pfam17144: Ribosomal_L5e 
Ribosomal large subunit proteins 60S L5, and 50S L18
This family contains the large 60S ribosomal L5 proteins from Eukaryota and the 50S L18 proteins from Archaea. It has been shown that the amino terminal 93 amino acids of Rat Rpl5 are necessary and sufficient to bind 5S rRNA in vitro, suggesting that the entire family has a function in rRNA binding.
Statistics
?
PSSM-Id: 319162
View PSSM: pfam17144
Aligned: 96 rows
Threshold Bit Score: 155.724
Threshold Setting Gi: 75272817
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VX7_R        14 KRYQVKYRRRREGKTDYRARKALILQDKNKYNAQKLRFVVRKTNSQVICQIACAHIEGDKILAEAKSKELIRYGIPVGLK 93
gi 75272817   14 SRFKLKKRRRRIGKTDYKKRMKLIRQDKKKFENKKKRIIIRFSKRNLSLQMVNSNVDGDFILLSSYLKNLSKLEYKNLTN 93
gi 326578163  10 SRKQLKRRRRREAKTNYKHRINLIRQDCNKQSAVKFRLVVRRSNKKVVCQITRAYVEGDRVFAYADSSELEKYGVNFGLK 89
gi 300706900  20 SRFQVKRRRRRECKTNYRHRINLIKQDYNKQGALKFRLVVRRTNTKVICQITRSYIDGDRVFAFADSTELKNYGVDFGLK 99
gi 630909215  13 SRFQTKLRRRREGKTDYKHRSAMIRQDANKQGAVKNRIVVRITNKKIICQVVKAYVVGDRTIVSADSTELKKYGINFGLT 92
gi 402469144  39 SRFQVKKRRRREGKTDYKQRRKLLTQDNTRYGVYKSRLVVRFTNTKVICAVVRPTYSGDNILCYADSTELKKYGINFGLT 118
gi 378756533  14 KRMRLPLRRRREGKTDYQQRHNLIRHNKANYGEVKSRFVVRITNTKVICQIVQAYTIGDKVICAADSTELKKYGITFGLK 93
gi 42491225   13 SRFQTKFRRRREAKTDYVQRTQLIQQDKTKYGAAKYRLVARITNTKVIAQIVVAELTGDKTVCQALSTELPKYGIKLGLS 92
gi 399949952  14 SRFQVKWRRRREGKTDYYSRKRMICQDKRKYTSPKYRMVVRKTKKNIICQFIQPKIEGDHVLSVVYSKNLKDFGIPLSYT 93
gi 330040707  14 SRFQVKWKRRRKGKTDYYSRKKMISKDKRKHNFHKYRVVVRFSKHNIVCQFINSKFEGDHILNSVYSSKLKKMGIYIGLT 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VX7_R        94 NYAAAYATGLLCARRFLKSLNLDTQFLGvekvtgeiennEdkeDeeGRKPIKAFLDVGITRTTTGNRVFAALKGACDGGL 173
gi 75272817   94 NYPFSYLLGYYFGKDLIEKVKQSETYNK-----------K---N--YSSKITAIIDIGLKRATIGNKSFASMKGSVDSGI 157
gi 326578163  90 NHFAFYATGFLVARRALEKLEMDELYKPkstng-einktEdieG--ERRALKVFLDIGLSRATKGANCFIAMKGASDAGI 166
gi 300706900 100 NHFAFYATGFLAGRRALAKLKMDDLYKAkktdg-tytitEdidE--ERRALKVFLDIGLSRSTKGGNTFIAMKGCSDAGV 176
gi 630909215  93 NYSAAYATGLLLARRMLAKQNLAEEFPAkeadg-eysvvEcneE--GKKPLTCYLDIGLNRSTKGARVFAAMKGCSDGGL 169
gi 402469144 119 NSSAAYLTGFLLGQRVLEKFSMKECGFGnneelgdyfvqEendD--GVKPFECFLDIGLKRATNGAKVFLAMKGASDAGV 196
gi 378756533  94 NYSAAYATGFLCARKMLTKLGLAGEYTGkeeidgeeyleSdneE--GPSAFRCYLDLGLARSSKGAKVFAAMKGACDGGL 171
gi 42491225   93 NYPAAYATGLLVARRFLTQMKLADVFKteite--eylndEe-----NRRPFKVILDVGLARTTTGAKVFAVMKGAVDGGL 165
gi 399949952  94 SFPSSYLSGLLLGKTISKN----KFLQLkkkik---------nekpfLKPIYAILDIGLGRTTTGHKIFAAMKGAIDGGI 160
gi 330040707  94 NFSCAYISGLLLSKNILQKNCLNGSYCLnak-----yviKk---------iRTCLDIGLTRATRGHKVFSCMKGIIDGGI 159

                 ....*
1VX7_R       174 NIPHG 178
gi 75272817  158 NIPHN 162
gi 326578163 167 FIPHS 171
gi 300706900 177 FIPHS 181
gi 630909215 170 RVPHS 174
gi 402469144 197 RVPHS 201
gi 378756533 172 HIPHS 176
gi 42491225  166 FIPHN 170
gi 399949952 161 AIPHK 165
gi 330040707 160 EIPHK 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap