Conserved Protein Domain Family
CHASE9

?
pfam17153: CHASE9 
Periplasmic sensor domain, extracellular
CHASE9 is a conserved extracellular (periplasmic) sensor domain found in histidine kinases, diguanylate cyclases/phosphodiesterases, methyl-accepting chemotaxis proteins, adenylate cyclases and protein serine phosphatases, including the c-di-GMP phosphodiesterases PdeI (YliE) of Escherichia coli (Hengge R. et al. ((2015)) [A systematic naming system for GGDEF- and EAL-containing c-di-GMP turnover proteins in Escherichia coli K-12]. J.Bacteriol., in preparation).
Statistics
?
PSSM-Id: 319171
View PSSM: pfam17153
Aligned: 5 rows
Threshold Bit Score: 174.63
Threshold Setting Gi: 754613997
Created: 1-Aug-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13634043   35 VSERAVKRADSRFELIQKNVGYFFKDIERSALTLKDSLYLLKNTEEIQRAVILKMEMMPFLDSVGLVLDDNKYYLFSRRA 114
gi 446209057  35 HKKIAESSSKNHQELLRNNLRNYFSKVEKEADALKDALYLLQDEEEIKRALIHRMAKIEGINLVGLMMNNGKYYSFIRTP 114
gi 507088245  35 HKKIAENSSRINLILINNNLNNFFSKVEKEADALKDAIYLLNDEGEIKRAVLHRMKKIDAVNLVGIMLNNGNYLSFIRTE 114
gi 754613997  35 HKKIAENSSRINLILINNNLNNFFSKVEKEADALKDAIYLLNDEGEIKRAVLHRMKKIDAVNLVGIMLNNGNYLSFIRTE 114
gi 446478098  35 VSDRAIKNAENRFELIEKNIGYFFNDIERDALTLKDSLYMLRREDEIIRAALLKMESMPYLDTIGLVMDNGKYLLFTRGV 114
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 13634043  115 NDKIVVYHQEQVNGPLVDESGRVIFADFNPSKRPWS 150
gi 446209057 115 GGEIKLQAKFVPGRPLTGADGEVIDENFNPLSRPWN 150
gi 507088245 115 NGEVKFLGKSEAGKPFIGDDGNISDNYFNPESRPWN 150
gi 754613997 115 DGEVKFLGKSEAGKPFIGDDGNISDNYFNPESRPWN 150
gi 446478098 115 NNKINVYHQNKINGPLVDQAGREVFKQFNPNKRPWS 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap