Conserved Protein Domain Family
GAPES2

?
pfam17156: GAPES2 
Gammaproteobacterial periplasmic sensor domain
GAPES2 (GAmmaproteobacterial PEriplasmic Sensor) domain is a periplasmic sensor domain found in diguanylate cyclases, including the diguanylate cyclase DgcI (YliF) of Escherichia coli (Hengge R. et al. ((2015)) [A systematic naming system for GGDEF- and EAL-containing c-di-GMP turnover proteins in Escherichia coli K-12]. J.Bacteriol., in preparation). It contains three conserved Cys residues that might participate in thiol-disulfide exchange.
Statistics
?
PSSM-Id: 319174
View PSSM: pfam17156
Aligned: 2 rows
Threshold Bit Score: 424.477
Threshold Setting Gi: 20140959
Created: 1-Aug-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20140959  26 IYTQMVKERVYSLKQSVIDTAFAVANIAEYRRSVAIDLINTLNPTEEQLLVGLRTAYADSVSPSYLYDVGPYLISSDECI 105
gi 20140959  26 IYTQMVKERVYSLKQSVIDTAFAVANIAEYRRSVAIDLINTLNPTEEQLLVGLRTAYADSVSPSYLYDVGPYLISSDECI 105
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20140959 106 QVKEFEKNYCADIMQVVKYRHVKNTGFISFDGKTFVYYLYPVTHNRSLIFLLGLERFSLLSKSLAMDSENLMFSLFKNGK 185
gi 20140959 106 QVKEFEKNYCADIMQVVKYRHVKNTGFISFDGKTFVYYLYPVTHNRSLIFLLGLERFSLLSKSLAMDSENLMFSLFKNGK 185
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....
gi 20140959 186 PVTGDEYNAKNAIFTVSEAMEHFAYLPTGLYVFAYKKDVYLRVC 229
gi 20140959 186 PVTGDEYNAKNAIFTVSEAMEHFAYLPTGLYVFAYKKDVYLRVC 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap