2CRB


Conserved Protein Domain Family
NRBF2_MIT

?
pfam17169: NRBF2_MIT 
MIT domain of nuclear receptor-binding factor 2
This MIT domain is the microtubule interaction and trafficking of nuclear receptor-binding factor 2 - NRBF2 - in higher eukaryotes. It is a coiled-coil region at the N-terminus of pfam08961. NRBF2 plays an essential role in autophagy, the cellular pathway that degrades long-lived proteins and other cytoplasmic contents through lysosomes. NRBF2 binds Atg14L - a Beclin-binding protein - directly via the MIT domain and enhances Atg14L-linked Vps34 kinase (a class III phosphatidylinositol-3 kinase) activity and autophagy induction.
Statistics
?
PSSM-Id: 319187
View PSSM: pfam17169
Aligned: 5 rows
Threshold Bit Score: 130.977
Threshold Setting Gi: 159163893
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CRB_A          8 MEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREER 87
gi 556983262    4 MESPLNLAHQQNRKAERLLAAGKYEEAIACHTKAAECLTEAMRLTKSEQAQLSLELQRESHIKQQRLIQEKWKRARRDER 83
gi 1003862587  12 MEGPLNLAHQQSRKADRLLAAGKYEEAISCHRKAAAYLTEAMKLTQSEQAQLSLELQRDSHMKQLLLIQERWKRAKREEK 91
gi 984136381    4 MEAPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSDAMKLTKSEQAHLSLELQRDSHMKQLLLIQERWKRAKREER 83
gi 752417646    4 MEGPLNLAHQQSRRADRLLAAGKFEEAISCHKKASAYLSEAMKLTQSEQAHLSLELQRESHAKQLLVIQERWTRAKREER 83

                  ...
2CRB_A         88 LKA 90
gi 556983262   84 QRA 86
gi 1003862587  92 MKA 94
gi 984136381   84 SKA 86
gi 752417646   84 LKA 86
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap