Conserved Protein Domain Family
DUF5130

?
pfam17174: DUF5130 
Domain of unknown function (DUF5130)
Statistics
?
PSSM-Id: 319192
View PSSM: pfam17174
Aligned: 16 rows
Threshold Bit Score: 191.023
Threshold Setting Gi: 498807543
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 614090079  26 LPPGWVLTTSGRISGVTEPGELSV-HYPFPIADLVALDDALTYSSRACQVRFAIYLGDLGRDTAARAREILGKVPTPDNA 104
gi 122364906  17 LPVGSVVTSSGRISGVHRVGEPFTdDLPFTTDELVRLDDALTEGTRKTKVRFNAYIGDLGADTAAGADALFPTTPEAERS 96
gi 502891085  17 LPIGTVITSSGRISAARQAGDSPV-NPPFTREELIGLDEALIRATRDAKARFSVYIGDLGDDVYAGAEAVLRQAPEPEYG 95
gi 493598422  17 LPHGAALTASGRISAVRGLGQAFT-GAPFKDRDLITLDDTLTHATRITNVRFTVYIGD-DENPAAATDALLPTTPDADNS 94
gi 503571795  22 LPLGAAQTSSGRISAVRFLDEPVE-KLPFDKDDLIRLDDALTFGTRTTGVKFTIYLGELGDNANDRAFDLLDSLDDPDHS 100
gi 262085318  23 LPLGTVITNSGRVSAARYPGQTPS-TPPFSRDELIALDDTLKAASEKALVRFSVYLGDLGAEPVVAAREVLAKAPEPAHG 101
gi 504125725  23 LPMGTVITNSGRVSATRFPGQAPS-TPPFSQRDLIDLDDALKAASEKALVRFSVYIGELGEDAVADARAVLAQAPEPANG 101
gi 753806859  14 LPHGYVVTSSGRVSGVHEAGDVFK-EAPFSDDERLAIDNVLTEATRATKVRFNIYIGDLGTDPAAGADAIFPSTPEAPAS 92
gi 752633425  17 LPRGWVVTTSGRLSGVTEPGELSV-HYPFPVNDLVFLDDALKYGSRAAKARFAVFLGDLGADTAATARQILAKVPTPDNA 95
gi 518341949  19 LPYGYALTSSGRISGVTEPGELSV-HYPFSVKDLVALDNALKYGSRYAKARFAVFIGDLGADTAATAREILAKVPTADNA 97
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 614090079 105 VLLAVSPNQCAIEVVYGSQVRGRGAESAAPLGVAAASSAFEQGELVDGLISAIRVLS 161
gi 122364906  97 VLIAVSPNQRTVEIRSGRAVANRVTDRVAQLGATAAVSSFGDGDLIDGLVSAIRVMS 153
gi 502891085  96 ALIAVSPNSNDIVVVTGREVADRLGDKVAQLGVTAAIPPFQKGDLIDGLIAALRVMA 152
gi 493598422  95 VLVAVFPNQRSIEIRSGRTAADRATDRVLQLGVTAAVSSFGQGNLLDGITSAVRVIA 151
gi 503571795 101 ALIAVSPGERKIEVVSGAAVVGKVGDRICQLGVTAAVPAFREGKLIDGLVAAVKVMS 157
gi 262085318 102 ALLAVSPNSRDVVVVSGAAVADRLNDRVAALGVTAAVTGFRQGQLIDGIIAALRVMA 158
gi 504125725 102 ALIAVSPNTHDVVVVSGARVADRVNDRVAQLGVTAAIGSFRSGQLIDGLIAALHVVA 158
gi 753806859  93 VLIAVSPNDKAIEVRSGREIADRANDRVCQLGVTAALSSFRQGQLIDGLVSAVRVMA 149
gi 752633425  96 VLLAVSPNQRAIEVVYGSEVSGRGIEESAPKGVAAAAELFKDGKLIPGLIKAVEVMS 152
gi 518341949  98 VLLAVSPNQKAIEVVYGSEVKGRGAETAAPLGISAALGSLRDGNLIDALVSAVNVMS 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap