2LO0


Conserved Protein Domain Family
Blt1_C

?
pfam17183: Blt1_C 
Click on image for an interactive view with Cn3D
Get5 carboxyl domain
During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localize with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localize to similar interphase structures. Physical interactions between Blt1-Mid1, Blt1-Cdr2 and Cdr2-Mid1 were detected, indicating that medial cortical nodes are formed by the ordered, Cdr2-dependent assembly of multiple interacting proteins during interphase. This entry corresponds to the C-terminal dimerization domain.
Statistics
?
PSSM-Id: 319201
View PSSM: pfam17183
Aligned: 15 rows
Threshold Bit Score: 78.9332
Threshold Setting Gi: 134083005
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
2LO0_A        24 PPKPAVGPSGESVVATEAFWDDLQGFLEQRLKDY--DEANKLRVLFKEAWRSS 74
gi 121776801 197 AAPVAQGLSGEGVLKTEVFWEDLKGFLQQRVRDE--GVAGDALGVFRGAWEGR 247
gi 121924225 176 AAPVAVGPSGKEVVATEEFWSDLKNFVMQRTKDE--AEAESLTKVFRGAWEDS 226
gi 154273911 179 STQDLVENDARNVLATEEFWDDLESFVKTKVKDA--VWASQIRSVFRKAWVSS 229
gi 758989818 237 AGPVAQGLSGPAVLETEEFWEDLKGYLQQRIRDE--KTAEEVVGRFRGAWSGK 287
gi 258571403 195 AKKLPADIENRNVLWSESFWEDLEGFLKMRIKDE--KEAARLRVLFKNAWESS 245
gi 134083005 179 apkaaVGPSGEEVLRMEAFWDDLQGFLEQRLKDSvyVKGRPMLAGFEYIYTSS 231
gi 212541845 186 PSKPAEGASGSEVLQTEEFWKDLEGFLELRTKDT--VESLRLAGIFKRAWQAD 236
gi 261200153 187 GPVENHPSTAQDVLSTEEFWDDLESFMTSKVKDP--AQASQIKSMFRKAWTSS 237
gi 189190436 180 GTAGSGAESGKDIVATDEFWGDLKAFMLQRIKDA--EEGERLVGVFKEAWQQN 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap