1T98


Conserved Protein Domain Family
MukF_M

?
pfam17192: MukF_M 
MukF middle domain
The kicA and kicB genes are found upstream of mukB. It has been suggested that the kicB gene encodes a killing factor and the kicA gene codes for a protein that suppresses the killing function of the kicB gene product. It was also demonstrated that KicA and KicB can function as a post-segregational killing system, when the genes are transferred from the E. coli chromosome onto a plasmid.
Statistics
?
PSSM-Id: 319210
View PSSM: pfam17192
Aligned: 13 rows
Threshold Bit Score: 278.898
Threshold Setting Gi: 506358829
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T98_B       121 STLRLSXQLSIVAGELKRAADAAEEG----GDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLXDEQQQQVKDDIAQLLNKD 196
gi 254764080 122 STLRLSIQLSIVADEIQRASNAAEEG----GDERFWRNQVFAPLKFSVAEIFDSIDLSQRMMDENQQQIRERIAMLLSQN 197
gi 41019150  121 SALRLSVQLSIVADEIQRASDSAEEGvennENEHYWRRNVFAPLKYSVAEIFDSIDLSQRIMDENQQSIKDEIAELLTKD 200
gi 41017317  121 STLRLSMQLSVVASELHRAAEAAEEG----GDEFHWHRNVFAPLKYSVAEIFDSIDMSQRVMDEQQSSVKEDIAALLNQD 196
gi 81399271  121 STLKLSIQLAMVADEINKAADAAQKG----GNEKHWRLNVYAVLKYSVAEIFDRIDLNQRTMDEQQLQVKTNIAELLTQD 196
gi 75352896  126 SKLKLSIQLAMVAEEIQKASEAAEKG----GEAKHWRKNVYGVLKYSVGEIFDRIDLNQRVMDEQQQSVKEEIAELLNQN 201
gi 41017410  126 SKLKLSIQLSMVADEMAKAVESAQQG----GSVAHWRKNVFGVLKYSVSEIFDRIDLNQRVMDEQQQSVKEQIADLLNKD 201
gi 506358829 124 NSVKLSLLLEQVAGELDKAYAAALHA----TDESAWDTEVYPRLKYSVEEILSRIDLTQRAMDDQQNQVKADIADLLNQN 199
gi 657060569 119 DSIKLSILLEHLAAELDTARKAALET----NTREQWDAEVLPRLTFSLEETLGRIDLTQRAMDEQQNQVKNEIAALLTQN 194
gi 753788078 121 SQIKLSLLLEHISQELERVAEAIAAN----PNEQGWAQNVEGRLKYSVAEQLARIDDTQRTMDEQQNAVKANIAALLNKN 196
gi 644445623 121 SSLRLSIQLSIVAQELKRAADAAVEG----GDDLHWHRNVFAPLKYSVAEIFDSIDITQRVMDEQQAEVKQNISALLSQD 196
gi 746013105 121 SALRLSVQLSIVADEIQRAAEAAEND----GDEYYWRREVFAPLKYSVAEIFDSIDLSQRIMDESQHQTKEEIAELLSKD 196
gi 506354472 121 STLRLSIQLSVLAKEIEQAANASEKNe---KEEAHWRQYVFAILKYSVSDMFDHIDMTQRAMDEQQNSVKEEVAALLHQD 197
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T98_B       197 WRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATXTHD-DLHFVDRLVFDLQSKLDRIISWGQQSIDLWI 275
gi 254764080 198 WHEAIATCQQLLDETSGNLRELQDVLNASGDKLQSQLLRIQSCLIGRD-DLDFVDQLIVNLQNKLDRIISWGQQAIDLWI 276
gi 41019150  201 WQAAISSCERLLDETSGNLRELQDTLNAAGDKLQAQLLRIQDCVIGRD-DLYFIDQLITDLQSKLDRIISWGQQAIDLWI 279
gi 41017317  197 WQAAIANCEQLLSETSGTLRELQDTLEAAGDKLQANLLRIQEANMDSG-GSELVDKLVFDLQSKLDRIISWGQQAIDLWI 275
gi 81399271  197 WRAAITNCEALLNETSSTLRELQDTLQAAGDQLQTQLLIIQEEVQGNS-ELDFVDGMIFILQMKLDRIISWGQQAIDLWI 275
gi 75352896  202 WREAISSCEKLLDETSGNLRELQDSLQAAGDQLQTELLNIQEIVYGNE-ELEFIDALLYSLQMKLDRIVSWGQQAIDLWI 280
gi 41017410  202 WRDAINNCEALLSETSATLRELQDTLQAAGDELQTQILDIQECVYGDL-ELDFIEETLSALQMKLDRITSWGQQSIDLWI 280
gi 506358829 200 WTQAIHNCEKLLRETGQTLRELQDTLDAAGHKLQSGLLNIQETSRAQAiSSVLVEQLTFDLQSRIDAILSWGQQCIELWA 279
gi 657060569 195 WVDAIHSCEKLLHETGQTLRELQDTLDAAGHRLQAGLLNIQEAAQGRD-DLFHVEELTHALQGRLDVITSWGQQCIELWA 273
gi 753788078 197 WHEAIHACEQLLRETGVTLRELQDTLDKAGHGLQQSLLNIEEQLQQSP-RGEAVAVLCQQLQARLDAIIHWGSQCIELWS 275
gi 644445623 197 WQAAISSCEGLLTETSQTLRELQDTLAAAGDKLQASLLLIQDATLDNP-ELDKINNVVLDLQSKLDRIIGWGQKAIDLWI 275
gi 746013105 197 WQAAISSCERLLDETSGNLRELQDTLNAAGDKLQAGLLRIQDCIVGRA-ELDFVEQLIISLQLKLDRIISWGQQAIDLWI 275
gi 506354472 198 WRTAIASCEVLLSETSSTLRELQDTLEAAGDQIQTHLLRIQSAVMDRS-ELEYIDKLIFTLQAKLDRTISWGQQSIDLWI 276

                 ....*.
1T98_B       276 GYDRHV 281
gi 254764080 277 GYDRHV 282
gi 41019150  280 GYDRHV 285
gi 41017317  276 GYDRHV 281
gi 81399271  276 GYDRHV 281
gi 75352896  281 GYDRHV 286
gi 41017410  281 GYDRHV 286
gi 506358829 280 RYDRHV 285
gi 657060569 274 RYDRHV 279
gi 753788078 276 RYDRHV 281
gi 644445623 276 GYDRHV 281
gi 746013105 276 SYDRYV 281
gi 506354472 277 GYDRHV 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap