3RPU


Conserved Protein Domain Family
MukF_C

?
pfam17193: MukF_C 
MukF C-terminal domain
This presumed domain is found at the C-terminus of the MukF protein.
Statistics
?
PSSM-Id: 319211
View PSSM: pfam17193
Aligned: 14 rows
Threshold Bit Score: 266.114
Threshold Setting Gi: 503512700
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3RPU_A       303 KFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMRDEEMA-LRDEEVTGELPEDLEYEEFNEIREQLAAI 381
gi 41019150  287 KFIRTAIDMDKNRVFSQRLRNSIHHYFDHPWFLWTAQAERLVDLRDEEMV-LREDDALGELPEELQYESLSDLHDQIVEH 365
gi 254764080 284 KFIRTAIDMDKNRVFGQRLRQSIQDYFESPWQLYIAKAEPLLDLRDDETE-LNEAEAVGELPTELEYESLTQVQEQIIAT 362
gi 41017410  288 KFIRTAIDMDQNRAFSQRLRQSMNDYFEQPWYLTYADAERLSDLRDETLT-LRDEEVTGHVPTEVEYEELQQVNDELAQR 366
gi 81399271  283 KFIRTAIDMDKNRAFSQRLRQSVTDYFDNPWLLTYADAERLLDMRDETLV-LRDDEVTGIVPEEMEFEELSQVNDQLSEQ 361
gi 75352896  288 KFIRTAIDMDKNRAFSQRLRDSVKGYFDAPWLLTYADAARLRDMRDEALI-LRDDEVTGIVPDEMEYEELSVITDILAER 366
gi 644445623 283 KFIRTAIDLDKNRVFSQRLRKSIQSYFDLPWSLTFANADRLLDMRDEELA-LHDAEVTGELPSELEFEMIEEIQEHIIRH 361
gi 372985618 309 RFIRTAIDMDKNRAFSQRLRESIRHFESHNWRLRVSQTLPLLELRDETMA-AYAEEVTGELPVALEYQDMTDIAAELSGR 387
gi 506354472 284 KFIRTAIDMDKNRVFAQRLRRSIQKYFDHPWALTFSDALRLLDIRDEQSSsLSNVESIGELPSELKFEGCDLIRSQLSSL 363
gi 503512700 283 KFIRTAIDLDKNRVFAQRLRRSIADYFDAPFYLWHVQAERLIDLRDEELA-LREEEALGELPTELEYESLQTVHEQISEA 361
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3RPU_A       382 IEEQLAVYKTRQVPLDLGLVVREYLSQYPRARHFDVARIVIDQAVRLGVAQADFTGLP-AKWQPINDYGAKVQAHVIDKY 460
gi 41019150  366 MQGLLIAYRENNRPIDLSLVLKEQLENYPLSRHFDVARIIVDQAVRLGMANDDLSGIY-PDWQAINKRGAEVQAHVIDKY 444
gi 254764080 363 MQAHLAPFREQGKPIDLGAILREQLAMYPLSRHFDVARIIVDQAVKLGMASQDSQAIY-PEWQSINDNGAEVQANVIDQY 441
gi 41017410  367 IGDMLKVHKEQGAAIDLALVLRDYLASHPRTHHFDLARMVVDQAVRLGYSESDYRAIQ-PDWTAINDFGAKVQANVIDRY 445
gi 81399271  362 VAEMLQAHKETGAAINLSLLLKDYLAQHPQARHFDVTRIVIDQAVRLGYSESDFNAIQ-PDWEAINEHGAKVQANVIDKY 440
gi 75352896  367 VAEMLQHHKDTGEAIELGTILKNYLSTYPHSQHFDLARLVVDQAVRLGYSEADFQAVQ-PDWQSINEFGAKVQANVIDKY 445
gi 644445623 362 IEQNLLIFKQENKPLDIGIAICSYLAQFPREQHFDIARLFIDQAIRLGIAEDDLLGIP-SEWKPINDYGAKVQAHVINRY 440
gi 372985618 388 IREHLEVFSVAGKPLDLAGVLRDYLNDYPHYQHFDIARLLIDEAVKLGHADGELAGAPmPDWQPINAHGAKVQAHVIDQY 467
gi 506354472 364 IEEALMVYQQKAIPLHLGQILRDYLKKYPVSQHFEVARILVDLALQLGVASEDFSGLS-AQWLPINDYGAQVQAHVIDQY 442
gi 503512700 362 MQALLIRYYETKQPIELGELLRQQLERYPQSQHFDVARIIVDQAVKLGIASQDFSGNV-PQWQPINDFGAEVQAHPIDEY 440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap