4WQO


Conserved Protein Domain Family
VHL_C

?
pfam17211: VHL_C 
VHL box domain
This domain represents the short C-terminal alpha helical domain from the VHL protein.
Statistics
?
PSSM-Id: 319229
View PSSM: pfam17211
Aligned: 10 rows
Threshold Bit Score: 87.4256
Threshold Setting Gi: 992224571
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
4WQO_A       169 ANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE 224
gi 556951591 102 VNITLPVYTLKERCLQVVRSLVKPEDYRRLEIVGSLYDDLENGPNVYRDLRRISHQ 157
gi 731121    115 ANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDYPSVRKDIQRLSQE 170
gi 432857142  97 VIITLPVDSLKDRALHVIRCLVQPEDYRKLEIARCLHEELEDQPNVLKDLQHINRl 152
gi 597781516 101 ANITLPVFSLRERCLQVVRQLVRSENFQRLEIARCLQEELAQRPNIQADLRRISQR 156
gi 992224571 110 VTVTSPVYSLQEYCLKLIRKLVRETDIDRLEIPGFLKKELHRSPDLLRDIQTLRAQ 165
gi 123702684 101 AKITLPVLTLRDRCLQVVRRLVRREDVGRLEIARCLQEDLAQRPSIQADLRRISQR 156
gi 551496662  97 VNITLPVDSLKDRALYAVRRLVRPEDYRKLEIARCLHEDLENPPNHRKDLQRINRR 152
gi 736167170  95 ANITLPVHSLKDRALQVIRRLVRAEDYRRLEIARCLHEELEDQPSILKDLHRMNQR 150
gi 363738805 119 ADITLPVFTLKERCLQVVRSLVRPGDYRKLDIVRSLYEELEDHPDVKKDLQRLSME 174
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap