2VNU,2VNU


Conserved Protein Domain Family
Rrp44_CSD1

?
pfam17216: Rrp44_CSD1 
Rrp44-like cold shock domain
Statistics
?
PSSM-Id: 319234
View PSSM: pfam17216
Aligned: 2 rows
Threshold Bit Score: 313.224
Threshold Setting Gi: 178847337
Created: 1-Aug-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                   10        20        30        40        50        60        70        80
           ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2VNU_D  11 DFTFPEYYSTARVXGGLKNGVLYQGNIQISEYNFLEGSVSLPRFSKPVLIVGQKNLNRAFNGDQVIVELLPQSEWKAPSS 90
2VNU_D  11 DFTFPEYYSTARVXGGLKNGVLYQGNIQISEYNFLEGSVSLPRFSKPVLIVGQKNLNRAFNGDQVIVELLPQSEWKAPSS 90
                   90       100       110       120       130       140
           ....*....|....*....|....*....|....*....|....*....|....*....|....*...
2VNU_D  91 IVLDSEHFDVNDNPDIEAGDDDDNNESSSNTTVISDKQRRLLAKDAXIAQRSKKIQPTAKVVYIQRRS 158
2VNU_D  91 IVLDSEHFDVNDNPDIEAGDDDDNNESSSNTTVISDKQRRLLAKDAXIAQRSKKIQPTAKVVYIQRRS 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap