3G5B


Conserved Protein Domain Family
UPA

?
pfam17217: UPA 
UPA domain
The UPA domain is conserved in UNC5, PIDD, and Ankyrins. It has a beta sandwich structure.
Statistics
?
PSSM-Id: 319235
View PSSM: pfam17217
Aligned: 15 rows
Threshold Bit Score: 217.61
Threshold Setting Gi: 676492340
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3G5B_A        151 AVKRLQLAIF-APALCTSLEYSLRVYCLEDTPAALKEVLELERTLGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSK 229
gi 657568550  271 AAKRLKLAVF-GPVSCTTLDYHIRVYCLDDTQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHTHWKSK 349
gi 961986115  310 AVKRLKLAVF-GSVEAGALNYSLRVYCVDDTPHAFQGVVAAETSRGGQLLEEPKTLPFRANTFSLQVSIQDVPQFLWSIK 388
gi 81230842   635 AIKRLRIAVF-GSMEASSLDYSLRVHCVDDTPHAFQGVVTAETCRGGQLLEEPKTLFFKGNCLSLQVSIQDIPQFLWSIK 713
gi 961945091  245 AAKRLRLAVFgSPDLSNSLGFTLRVYCVDDTPYAFQEVVVGERSRGGRLLEEPKILLFKGNTFSLQVSIQDVPRLLWSIK 324
gi 992182677  612 AGKRLRLAVF-GNLEADALTYSLRVYCVDDTPYAFQEVVWLERGQGGRLLEEPKTLLFKANCFSLQISIQDVPQFLWSIK 690
gi 193783712  263 AVKQLKVAVF-GCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIK 341
gi 676492340  619 AIKILRLAAF-APAAPPAMDYSIRVYVVEDTHDGLEGVIQMEKKLGGRLLDKPKQIPFQDCGNNLCLSIEELSP-GWRSK 696
gi 678003784  246 ASKRLKLVLF-APAACPSLEYNIRVYCLSDTQDVLKEVIQLEKQLGGQLIGAPRVLHFKDSYHNLRLSIHDMPSSLWKSK 324
gi 602641206  599 ASKRLKLVLF-APTTCTGLEYDVRVYCLSDTRDALKEVVQIEKQMGGQLIGAPRILHFKDSYHNLRLSIHDVPSSLWKSK 677
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
3G5B_A        230 LLAKYQEIPFYHVWNGSQKALHCTFTLERHSLASTEFTCKVCVRQ--VEGEGQIFQLHTTLAE 290
gi 657568550  350 LIAKYQEIPFYQVWSGSQRSLHCTFTLERLSAATTEISCKLCVRQ--VEGEGQIFQLSNTLEE 410
gi 961986115  389 PFTTCQEFSFPQVWCSNQQPLHCAFQLERYSPAATQLSCKISVRQ--VKGHEQILQVYTAVAE 449
gi 81230842   714 PFTTCQEFSFTQVWYSNQQPVHCAFSLQRHSAATNQLSCKISVRQ--VKGHEQILQVYTSVGE 774
gi 961945091  325 PFTTCQEFSFSQVWASNRCPLQCAFSLERYSLSSSQLSCKISVRQ--VTGEEQILQIYTSVVE 385
gi 992182677  691 PFTTCQEFGFSQVWGSNQSPLQCAFTLERFSQATNQLSCKISIRQ--VKGQEQILQVYTTVGE 751
gi 193783712  342 PFTACQEVPFSRVWCSNRQPLHCAFSLERYTPTTTQLSCKICIRQ--LKGHEQILQVQTSILE 402
gi 676492340  697 LAANYQEIPFRHIWSGNQNNLHCSFSVESIDRIQSNVSCKIQVYQkaVPNNRQVIRISSNIKE 759
gi 678003784  325 LLASYQEIPFYHIWSGLQPFLHCTFTLERLSTSTCELACKIWVWQ--VEGDGQSFTVNFNIAK 385
gi 602641206  678 LLVSYQEIPFYHLWSGLQPYLHCTFTLERLSTNTCQLACKIWIWQ--VEGDGQSFNIDFNIAK 738
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap