3IXS


Conserved Protein Domain Family
YAF2_RYBP

?
pfam17219: YAF2_RYBP 
Yaf2/RYBP C-terminal binding motif
This motif is found in the Yaf2 and RYBP proteins that are homologous parts of the PRC1 complex. This motif forms a beta hairpin structure when it binds to the RAWUL domain pfam16207.
Statistics
?
PSSM-Id: 319237
View PSSM: pfam17219
Aligned: 20 rows
Threshold Bit Score: 27.222
Threshold Setting Gi: 761906593
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|....
3IXS_B          3 RPRLKN-VDRSTAQQLAVTVGNVTVIITDFKEKT 35
gi 565317581   49 TPDVGE-RWKRPGSRHPVTVGNVTVIITDFKEKt 81
gi 1032745421  79 PPRLKN-IDRSTAQSNEVTVNNVTVVITEYKPKV 111
gi 357602529   85 PPRLNN-VDRSSAQTREVTVSGVTVVITEYKPKK 117
gi 242014664   99 LRKLKN-VDRNSAETREVTVNNITVMITEYKPKP 131
gi 674590466  114 PTFPRNaVDRTCPQQFEVFANGFSVVITEYLPKV 147
gi 478258101   94 LPRLKN-VDRSTAQTREVTVNSITVVITEYKPKI 126
gi 390335124   92 RPRLKN-VDRSTAISTQVVVNDVPVIITEYREKA 124
gi 669305139  181 DHQLLT-LDVNSARTLAVTADDVTVIITDYSLTP 213
gi 676475543   90 RSRLKN-IDRLGGEKMEVTVNDVTVLITDYKPKQ 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap