Conserved Protein Domain Family
Peptidase_C107

?
pfam17222: Peptidase_C107 
Viral cysteine endopeptidase C107
This is a family of viral cysteine endopeptidases that process RNA polyproteins. Site directed mutagenesis suggest that H1434 and C1539 form the catalytic dyad.
Statistics
?
PSSM-Id: 319240
View PSSM: pfam17222
Aligned: 2 rows
Threshold Bit Score: 688.376
Threshold Setting Gi: 566594662
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 566594662 1387 SAASNPSISHIVLEMPVAINPLIKYTTRTSVSSLRGAVVNGYIYIQRHLFGSKKQEFEACYNNGKGLLNCKNLERSKYDI 1466
gi 338209350 1387 SAASNPSISHIVLEMPVAINPLIKYTTRTSVSSLRGAVVNGYIYIQRHLFGSKKQEFEACYNNGKGLLNCKNLERSKYDI 1466
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 566594662 1467 DSAELIGTLIRIPLHDKHSIPHISIHPDPLSYNGPVTLYLSRYDTELNKDVLCVHTGFMSEGHHDIKTVFGDCGGMLFDP 1546
gi 338209350 1467 DSAELIGTLIRIPLHDKHSIPHISIHPDPLSYNGPVTLYLSRYDTELNKDVLCVHTGFMSEGHHDIKTVFGDCGGMLFDP 1546
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 566594662 1547 KGRLLGLHCAGSDDVVFMDTTTGKSNIWTSYKLQHPSEIMITLNNEINLPNPANYDFETTKVVYQHPLRNVCATLETLQH 1626
gi 338209350 1547 KGRLLGLHCAGSDDVVFMDTTTGKSNIWTSYKLQHPSEIMITLNNEINLPNPANYDFETTKVVYQHPLRNVCATLETLQH 1626
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 566594662 1627 LTNKTNAKLPYDSRLLSDFNITAEQYNQYGYYIDYNNFVNNFNRYTTTTIGTKSFETCIKYGLMDNKKPDYYNQ 1700
gi 338209350 1627 LTNKTNAKLPYDSRLLSDFNITAEQYNQYGYYIDYNNFVNNFNRYTTTTIGTKSFETCIKYGLMDNKKPDYYNQ 1700
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap