Conserved Protein Domain Family
IX

?
PHA00024: IX 
minor coat protein
Statistics
?
PSSM-Id: 106880
View PSSM: PHA00024
Aligned: 5 rows
Threshold Bit Score: 31.6079
Threshold Setting Gi: 9626237
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30
               ....*....|....*....|....*....|...
gi 9626237   1 MIDYVGSFLGAYFLGFALFYGIGFFKSISNRII 33
gi 9625387   1 MIDYVGLFIGAYIMGFALFYGIGFFKSIAERIV 33
gi 9630750   1 -MSALSYFFAAYCIGWVISHSILVFKKLSEVST 32
gi 17426222  1 -MSVLVYSFASFVLGWCLRSGITYFTRLMETSS 32
gi 9630765   4 FQFLLPTFFGALIMGYAVGFKWLVFKKATEAIA 36
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap