Conserved Protein Domain Family
cp

?
PHA00026: cp 
coat protein
Statistics
?
PSSM-Id: 133846
View PSSM: PHA00026
Aligned: 2 rows
Threshold Bit Score: 240.328
Threshold Setting Gi: 9626427
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9626427   1 MATLRSFVLVDNGGTGNVTVVPVSNANGVAEWLSNNSRSQAYRVTASYRASGADKRKYAIKLEVPKIVTQVVNGVELPGS 80
gi 9626313   2 ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVA 81
                       90       100       110       120
               ....*....|....*....|....*....|....*....|....*....
gi 9626427  81 AWKAYASIDLTIPIFAATDDVTVISKSLAGLFKVGNPIAEAISSQSGFY 129
gi 9626313  82 AWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap