Conserved Protein Domain Family
lys

?
PHA00027: lys 
lysis protein
Statistics
?
PSSM-Id: 133847
View PSSM: PHA00027
Aligned: 2 rows
Threshold Bit Score: 88.5316
Threshold Setting Gi: 9626314
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 9626314   18 RRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLLEAVIRTVTTLQQLLT 75
gi 189423028  1 MGLKAKHKENLCSDSERSKRLYVWIALAIVLSDFTSIFSHWIWGLLILYLQTLMDLPT 58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap