Conserved Protein Domain Family
VI

?
PHA00094: VI 
minor coat protein
Statistics
?
PSSM-Id: 106886
View PSSM: PHA00094
Aligned: 4 rows
Threshold Bit Score: 91.4207
Threshold Setting Gi: 9630768
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9626240    1 MPALLG------IPALIRFIMGLVPIAIGYFAKFLGMIITRNGLMASALIGAILSVVSFSIQLLGDALSSsmggISADFG 74
gi 9630753    1 MPVFLG------LPVLARFIGWLAGALIAYVAKFFTLGIARIALAISLFLGLIIGLNGLLVSYLSDLTSV----LPPEIA 70
gi 9630768    8 LPIITGitgalrIPAIAAFLATLAANILSWFSERFTRAVAINLTVLTMVIGLALAAASAMYALAAGLAEI----TPPYVV 83
gi 17426225   1 MPVLLG------IPLLLRFLGFLLVTLFGYLLTFLKKGFGKIAIAISLFLALIIGLNSILVGYLSDISAQ----LPSDFV 70
                        90       100       110       120
                ....*....|....*....|....*....|....*....|..
gi 9626240   75 NLMSSVLPDGTTTCITVIITTRIAVFVFDIKDRLLGIANKVI 116
gi 9630753   71 SAVSYVVPANAAPCLYAIFSLKAAVFIFDVKDRIIGYLDWNK 112
gi 9630768   84 DAWGMFVPSNAIPCVAAIFSAKVIRWVW----------GWQF 115
gi 17426225  71 QGVQLILPSNALPCFYVILSVKAAIFIFDVKQKIVSYLDWDK 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap