Conserved Protein Domain Family
PHA00280

?
PHA00280: PHA00280 
putative NHN endonuclease
Statistics
?
PSSM-Id: 106901
View PSSM: PHA00280
Aligned: 3 rows
Threshold Bit Score: 117.962
Threshold Setting Gi: 9627446
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9627446    1 MRKSYKQFYKAPRRHIQVWEAANGPIPKGYYIDHIDGNPLNDALDNLRLALPKENSWNMKTPKSNTSGLKGLSWSKEREM 80
gi 30387469   1 MRKSYKQFYKAPRRHIQVWEAANGPIPKGYYIDHIDGNPLNDALDNLRLALPKENSWNMKTPKSNTSGLKGLSWSKEREM 80
gi 29366715   3 SPKSYLQ-TTSGRVHVKVWEEAHGPVPKGMHVDHRNGDIHDNRLENLRLATPAQNIANSKLSEANKTGLKGLSWDSARGR 81
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 9627446   81 WRGTVTAEGKQHNFRSRDLLEVVAWIYRTRRELHGQFARFR 121
gi 30387469  81 WRGTVTAEGKQHNFRSRDLLEVVAWIYRTRRELHGQFARFR 121
gi 29366715  82 FKGAVRLNRKQYTTRG-DLLTVAAWLFRTREALHGEFARHR 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap