Conserved Protein Domain Family
PHA00380

?
PHA00380: PHA00380 
tail protein
Statistics
?
PSSM-Id: 133872
View PSSM: PHA00380
Aligned: 3 rows
Threshold Bit Score: 996.734
Threshold Setting Gi: 12248116
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194186883   1 MAYVPLSGTNVRILADVPFSNDYKNTRWFTSSSNQYNWFNSKSRVYEMSKVTFMGFRENK---PYVSVSLPIDKLYSASY 77
gi 12248116    1 MPTLPTSGTDVVFMSGIPFTSDYKHTRWFGSKAEQTVYFGNQTVRHQEAEVVFTGSKENRanrSYVTIDVPYDDVYDVNY 80
gi 22855157    1 MAYVPLSGTDVRIFSNVPFSNDYKSTRWFTNADAQYSYFNAKPRVHVINECNFVGLKEGT---PHIRVNKRIDDLYNACY 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194186883  78 IMFQNADYGNKWFYAFVTELEFKNSAVTYVHFEIDVLQTWMFDIKFQESFIVREHVKLWNDDGTPTINTIDEGLSYGSEY 157
gi 12248116   81 FMFNNKSYMNRWFYAFVTKIEYVNSSRTRMYFTIDVIQTWMFEIDFQPSYVKREHQTEYQSNGKPVVNTIPEKLDYGTDY 160
gi 22855157   78 MIFRNTQYSNKWFYCFVTRLEYVNSGVTNLYFEIDVIQTWMFDFKFQPSYIVREHQEMWDANNEPLTNTIDEGLNYGTEY 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194186883 158 DIVSVENHKPYDDMMFLVIISKSIMHGTPGEEEsrlnDINASLNGMPQPLCYYIHPFYKDGKVPKTYIGDNNANLS---- 233
gi 12248116  161 DTIYEYHFNPFEGLQWLVIQAKQEIHTVEEGDQ----QISPSFIGAPQPLVTYLYPVNRNGTGRFPVVEVNHFERKfdpk 236
gi 22855157  158 DVVAVEQYKPYGDLMFMVCISKSKMHAT-AGETfkagEIAANINGAPQPLSYYVHPFYEDGSSPKVTIGSNEVQVS---- 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194186883 234 ------PIVNMLTNIFSQKSAVNDIVNMYVTDYIGLKLDYK--NGDKELKLDKDMFEQAGIADDKHGNVDTIFVKKIPDY 305
gi 12248116  237 ktdfefPVEDVLKEIYKNESSVNNVVNIFLTENTGLPMSVSgtGGNMTVNFTDECFIQSRVIGDKLDPIPLLQLTFAPNF 316
gi 22855157  233 ------KPTDFLKNMFTQEHAVNNIVSLYVTDYIGLNIHYD--ESAKTMSLRDTMFEHAQIADDKHPNVNTIYLKEVKEY 304
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194186883 306 EALEIDTGDKWGGFTKDQESKLMMYPYCVTEITDFKGNHMNLKTEYINNsKLKIQVRGSLGVSNKVAYSVQDYNADSALs 385
gi 12248116  317 HFLKKSLFDQYDVITKPTESKLLMYPYTILIMDDFKGNRVEYKLEYIDG-KVEVIAKGSVGVNNKTSYTIDNYNNLSEF- 394
gi 22855157  305 EEKTIDTGYKFASFANNEQSKLLMYPYCVTTITDFKGNQIDIKNEYVNGsNLKIQVRGSLGVSNKVTYSVQDYNADTTLs 384
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194186883 386 ggnrltASLDSSLINNNPNDIAILNDYLSAYLQGNKNSLENQKSSILFNGIMGMIGGGISAGAS----------AAGGSA 455
gi 12248116  395 ------ASIEAGFINDSPNDIAIVNDYTSAYMQGNANSLRNRLDAAAFSGITNTIGSTLSAVGSlpsvdtatqgGGANLA 468
gi 22855157  385 gdqnltASCNTSLINNNPNDVAIINDYLSAYLQGNKNSLENQKDSILFNGVMSMLGNGIGAVGS----------AATGSA 454
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194186883 456 LGMASSVTGMTSTAGNAVLQMQAMQAKQADIANIPPQLTKMGGNTAFDYGNGYRGVYVIKKQLKAEYRRSLSSFFHKYGY 535
gi 12248116  469 LGTAQSANNLVQTAGQSVFNIQGIDAQLKDINNMPPNLVKMGGNIAFSFGNLYSGVRFMIKQIKPEYYSKLKGFFKSYGY 548
gi 22855157  455 VGVASSATGMVSSAGNAVLQIQGMQAKQADIANTPPQLVKMGGNTAYDYGNGYRGVYVIKKQIKEEYRNILSDFSRKYGY 534
                        570       580       590       600       610       620
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 194186883 536 KINRVKKPNLRTRKAFNYVQTKDCFISGDINNNDLQEIRTIFDNGITLWHTDNIGNYSVENELR 599
gi 12248116  549 KSNRIKIPNLRTRTAFNYVETEGCNIKGNIPNEDLNDLKAIFDGGITLWHVNDVGNYNVTNGVR 612
gi 22855157  535 KTNLVKMPNLRTRESYNYVQTKDCNIIGNLNNEDLQKIRTIFDSGITLWHADPVGDYTLNNEVR 598
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap