Conserved Protein Domain Family
PHA00438

?
PHA00438: PHA00438 
hypothetical protein
Statistics
?
PSSM-Id: 133887
View PSSM: PHA00438
Aligned: 15 rows
Threshold Bit Score: 122.955
Threshold Setting Gi: 29366723
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17570820   1 MLQPINHVLTHPDDIPSMPRAAKEYLQVRFNQAYVMESGEYRALRAAGYSESFIAGVMHGLYLASRTLDEIEVRKEQLRQ 80
gi 9634029    1 MLQPINHVLTHPDDIPSMPRAAKEYLQVRFNQTYVMESGEYRALRAAGYSESFIAGVMHGLYLASRTLDEIEVRKEQLRQ 80
gi 119637771  1 MLTPIKKYMENPQDIPNVPRSVMEYLQVQYNAGYAIQSGLINRLKQAGWSESYIAGFLAGLNYASQTLDDMEAIRKEQAE 80
gi 29366723   1 MLKVIQHHIQNPDDIPDIAPAAAEYLAVRLNASYLIATGIVDDLRKQGYSEGYIAGFLDGANAAVEITELMQEAQLQKEE 80
gi 77118192   6 IENVVKQLQEERLDVPNISQSAIQFLHVLFNASYAEKMGAISLLKQQGYSDAFIAGFIKGLQYCSDTLDSAIAMRRELKD 85
gi 194100284  1 MLTPIKKYMENPQDIPNVPRSVMEYLQVQYNAGYAIQSGLINRLKQAGWSESYIAGFLAGLNYASQTLDDMEAIRKEQAE 80
gi 194100445  1 MLKPIEHILNNPNDLPDVPRAVKEYLQSRFNADFLYQS-EVRKLREAGHSEEFISGVLYGHYMASRVLDEMEGRQRALKE 79
gi 194100493  1 MLTPIKKYMENPQDIPNVPRSVMEYLQVQYNAGYAIQSGLINRLKQAGWSESYIAGFLAGLNYASQTLDDMEAIRKEQAE 80
gi 189427227  1 MLQPINHVLTHPDDIPSMPRAAKEYLQVRFNQAYVMESGEYRALRAAGYSESFIAGVMHGLYLASRTLDEIEVRKEQLRQ 80
gi 212671408  1 MLTPIKKYMENPQDIPNVPRATMEYLQVQYNAGYAIQSGLINRLKQAGWSESYIAGFLAGLNYASQTLDDMEAIRKEQAE 80

                .
gi 17570820  81 E 81
gi 9634029   81 E 81
gi 119637771 81 S 81
gi 29366723     -
gi 77118192  86 T 86
gi 194100284 81 S 81
gi 194100445 80 G 80
gi 194100493 81 S 81
gi 189427227 81 E 81
gi 212671408 81 S 81
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap