Conserved Protein Domain Family
PHA00440

?
PHA00440: PHA00440 
host protein H-NS-interacting protein
Statistics
?
PSSM-Id: 133889
View PSSM: PHA00440
Aligned: 7 rows
Threshold Bit Score: 154.616
Threshold Setting Gi: 194100279
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9634023     1 MAMTKHFKVTFDVTAVIDSESEKNLNELLVDLAKKAGAGEKL-NPFKQELLIQGLTHGPEGAAAFCIKQGLREFIRDGHS 79
gi 17570815    1 MAITKKFKVSFDVTLKLDSETEELMREKILDLAHRAGAGEEI-TPMDRELLVQALTRGPDGAAAFAVRQGIRNAVKEMFE 79
gi 30387475    1 MTITKKFKVSFDVTLKLDSETEELMREKILDLAHRAGAGEEI-APMDRELLVQALTRGPDGAAAFAVRQGIRTNVKEMFE 79
gi 9627456     1 MAMTKKFKVSFDVTAKMSSDVQAILEKDMLHLCKQVGSGAIVpNGKQKEMIVQFLTHGMEGLMTFVVRTSFREAIKDMHE 80
gi 194100279   1 MAITKRFKVSFEMTVKVDSETEVMIQERILDLARSVRDGEEV-SAQDKELLVQALTHGADGVVAFAVKQGIRNEIREMGI 79
gi 194100385   1 MAMTKKFKVSFDVTAKMPSDVQAILEKDMLHLCKQVGSGEIVpNGKQKEMIVQFLTHGMEGLMAFVVRTSFREAIKDMHE 80
gi 189427220   1 MAMTKHFKVTFDVTAVIDSESEKNLNELLVDLAKKAGAGEKL-NPFKQELLIQGLTHGPEGAAAFCIKQGLREFIRDGHS 79
                         90       100
                 ....*....|....*....|.
gi 9634023    80 ElsSTEQKLMRFSPATVREVF 100
gi 17570815   80 E--TSDKSLLKLSPATVREVF 98
gi 30387475   80 E--SGDKSMFKVSPATVREVF 98
gi 9627456    81 E--YADKDSFKQSPATVREVF 99
gi 194100279  80 E---HHGEGIKFAPATIREVK 97
gi 194100385  81 E--YSDKDSFKLSPATVREVF 99
gi 189427220  80 ElsSTEQKLMRFSPATVREVF 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap