Conserved Protein Domain Family
PHA00448

?
PHA00448: PHA00448 
hypothetical protein
Statistics
?
PSSM-Id: 133894
View PSSM: PHA00448
Aligned: 9 rows
Threshold Bit Score: 74.9837
Threshold Setting Gi: 9634017
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119637763  1 MFNFINTLGKLVVKLYFCEAKRINNKARKDAERAQRLAKHARMLSEAASAGVTSAAKIAAKATDLDKFFL 70
gi 9627451    1 MFKLIKKLGQLLVRMYNVEAKRLNDEARKEATQSRALAIRSNELADSASTKVTEAARVANQAQQLSKFFE 70
gi 9634017    1 MFKFINALGKLVVKLYFIEAKKLDKKAKADSQRAIELAKQSREKSDAAVSGIHKSAAIAAKAQSMSKFFE 70
gi 30387471   1 MFKLIKKLGQLLVRMYNVEAKRLNDEARKEATQSRALAIRSNELADSASTKVTEAARVANQAQQLSKFFE 70
gi 17570809   1 MFKFINTLGKLVVKLYFIEAKKLDKKAKADSQRAIELAKQSREKSDAAVSGVHKSAAIAAKAQSMSKFFE 70
gi 189427217  1 MFKFINALGKLVVKLYFIEAKKLDKKAKADSQRAIELAKQSREKSDAAVSGIHKSAAIAAKAQSMSKFFE 70
gi 194100381  1 MFKLIKKLGQLLVRMYNVEAKRLNDEARKEATQSRTLAIRANELADSASNKVTEAARVANQAQQLSKFFE 70
gi 194100486  1 MFNFINTLGKLVVKLYFCEAKRINNKARKDAERAQRLAKHARMLSEAASAGVTSAAKIAAKATDLDKFFL 70
gi 194100273  1 MFKFINTLGKLVVKMYFREAKRLNDKARKDAEQAQRLAKQARLLSEDASAGVTSAAKIAAKATDLNKFFL 70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap