Conserved Protein Domain Family
PHA00490

?
PHA00490: PHA00490 
terminal protein
Statistics
?
PSSM-Id: 133906
View PSSM: PHA00490
Aligned: 3 rows
Threshold Bit Score: 395.063
Threshold Setting Gi: 12248110
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22855150    1 MARNSRIRITNNDKALYAKLVKNTKAKISRTKKKYGIDLSNEIELPPLESFQTRKEFNEWKRKQESFTNRANQNYQFVKN 80
gi 12248110    1 MARESDFRLTKAQREEVSKLSRSVKAKTTRLLKNYGQDFTGYISPKSPDDIKSIEQFNAFKKRAESFTDRSNRDFQFVKN 80
gi 194186875   1 MARSPRIRIKDNDKAEYARLVKNTKAKIARTKKKYGVDLTAEIDIPDLDSFETRAQFNKWKEQASSFTNRANMRYQFEKN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22855150   81 KYGIVASKAKINEIEKNTKEAQRIVDEQREEIEDKPFISGGKQQG-TVGQRMQILSPSQvTGVSRPSDFNFDDVRSYARL 159
gi 12248110   81 EYGVVVSKTELDEILSDTKKAQEVAEKILDRFNDVEVISGGQSTGfTVGENKELLAKPD-KGFGRIEDFDFNKVKTQEGL 159
gi 194186875  81 AYGVVASKAKIAEIERNTKEVQRLVDEKIKAMKDKEYYAGGKPQG-TIEQRIAMTSPAHvTGINRPHDFDFSKVRSYSRL 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22855150  160 RTLEEGMAEKASPDYYDRRMAQMHQNFIE-IVEKSFNSywLTDELVERLKKIPPDDFFELYLIFDEISFEYFDSEGEDVE 238
gi 12248110  160 DRFANRAKKRSQEAYYEESLRRLQDNFIRnSVEGTFNS--EADDVVSKLRSLPADDFYECFSIYNEISFENFDSENALGM 237
gi 194186875 160 RTLEESMEMRTDPQYYEKKMIQLQLNFIK-SVEGSFNSfdAADELIEELKKIPPDDFYELFLRISEISFEEFDSEGNTVE 238
                        250       260
                 ....*....|....*....|....*...
gi 22855150  239 ASEAMLNKIHSYLDRYERGDVNLDLKGF 266
gi 12248110  238 ASESILERVRMYVNDYFEGKSDLSLKGF 265
gi 194186875 239 NVEGNVYKILSYLEQYRRGDFDLSLKGF 266
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap