Conserved Protein Domain Family
PHA00542

?
PHA00542: PHA00542 
putative Cro-like protein
Statistics
?
PSSM-Id: 106954
View PSSM: PHA00542
Aligned: 5 rows
Threshold Bit Score: 52.8777
Threshold Setting Gi: 45569524
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45569524   1 MEKAMPATTPTIPAAYTQRPDELVCALIRAGWSQEQIADATDVSQPTICRIYSGRHKDPRYSVVEKLRHLVLNLDDFQQV 80
gi 9633551    5 IFKHLKEMNNWRKTVYKKSPIEIVQALLAQGLTQSEIEANTGIKQPSISRILTGKNKDPRISTMVALEKLYLELATNSFS 84
gi 41179392   1 MEKAMPATTPTIPAAYTQRPDELVCALIRAGWSQEQIADATDVSQPTICRIYSGRHKDPRYSVVEKLRHLVLNLDDFQQV 80
gi 45580775   1 MEKAMPATTPTIPAAYTQRPDELVCALIRAGWSQEQIADATDVSQPTICRIYSGRHKDPRYSVVEKLRHLVLNLDDFQQV 80
gi 212499707  5 IFKHLKEMNNWRKTVYKKSPIEIVQALLAQGLTQSEIEANTGIKQPSISRILTGKNKDPRISTMVALEKLYLELATNSFS 84

                ..
gi 45569524  81 TR 82
gi 9633551   85 TS 86
gi 41179392  81 TR 82
gi 45580775  81 TR 82
gi 212499707 85 TS 86
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap