Conserved Protein Domain Family
PHA00626

?
PHA00626: PHA00626 
hypothetical protein
Statistics
?
PSSM-Id: 106959
View PSSM: PHA00626
Aligned: 3 rows
Threshold Bit Score: 90.5529
Threshold Setting Gi: 9635496
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....*....
gi 13559827  1 MSCPKCGSGNIAKEKTMRGWSGDYVCCDCGYNDSKDAFGERGKNEFVKINKESEGNEKS 59
gi 9635496   1 MSCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSKDAFGERGKNEFVRINKERKGNEKS 59
gi 24371541  1 MSCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSKDAFGERGKNEFVRINKERKGNEKS 59
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap