Conserved Protein Domain Family
PHA00649

?
PHA00649: PHA00649 
hypothetical protein
Statistics
?
PSSM-Id: 106962
View PSSM: PHA00649
Aligned: 3 rows
Threshold Bit Score: 162.926
Threshold Setting Gi: 41179365
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179365  1 MSDQHCDTPACQEAADRAVKKVFAILGVDVDVPEQVEEFREDLRFGRRMRKAADHGFLALVGLVAVALGAAVWAGITSKL 80
gi 45580748  1 MSDQHCDTPACQEAADRAVKKVFAILGVDVDVPEQVEEFREDLRFGRRMRKAADHGFLALVGLVAVALGAAVWAGITSKL 80
gi 45569497  1 MSDQHCDTPACQEAADRAVKKVFAILGVDVDVPEQVEEFREDLRFGRRMRKAADHGFLALVGLVAVALGAAVWAGITSKL 80

               ...
gi 41179365 81 GGH 83
gi 45580748 81 GGH 83
gi 45569497 81 GGH 83
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap