Conserved Protein Domain Family
PHA00650

?
PHA00650: PHA00650 
hypothetical protein
Statistics
?
PSSM-Id: 106963
View PSSM: PHA00650
Aligned: 3 rows
Threshold Bit Score: 169.542
Threshold Setting Gi: 45580749
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45580749  1 MASPVINTREDLDALAGTPAHGEFLDYLRGSITRKQDAQTYPDGYDTPDYEGPTLDPVWQDVEDLSTIERFGFTKAELLG 80
gi 45569498  1 MASPVINTREDLDALAGTPAHGEFLDYLRGSITRKQDAQTYPDGYDTPDYEGPTLDPVWQDVEDLSTIERFGFTKAELLG 80
gi 41179366  1 MASPVINTREDLDALAGTPAHGEFLDYLRGSITRKQDAQTYPDGYDTPDYEGPTLDPVWQDVEDLSTIERFGFTKAELLG 80

               ..
gi 45580749 81 GE 82
gi 45569498 81 GE 82
gi 41179366 81 GE 82
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap