Conserved Protein Domain Family
PHA00657

?
PHA00657: PHA00657 
crystallin beta/gamma motif-containing protein
Statistics
?
PSSM-Id: 106966
View PSSM: PHA00657
Aligned: 3 rows
Threshold Bit Score: 4188.76
Threshold Setting Gi: 41179371
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371    1 MSNEFDAAVAGTLGQQPAQDTTADPFDAAVAGVLRPDQGQAARAGFVLASDTDPDAYAEAQRVARRANLPIETVLNQPKE 80
gi 45580754    1 MSNEFDAAVAGTLGQQPAQDTTADPFDAAVAGVLRPDQGQAARAGFVLASDTDPDAYAEAQRVARRANLPIETVLNQPKE 80
gi 45569503    1 MSNEFDAAVAGTLGQQPAQDTTADPFDAAVAGVLRPDQGQAARAGFVLASDTDPDAYAEAQRVARRANLPIETVLNQPKE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371   81 AKRQDTIGAIDFDTLGKTSPATAALLADVEKAKIAHDNVDNMTGIESVLSSLGTAVKYLVSAPDQKNTLMGDIGAGFAQA 160
gi 45580754   81 AKRQDTIGAIDFDTLGKTSPATAALLADVEKAKIAHDNVDNMTGIESVLSSLGTAVKYLVSAPDQKNTLMGDIGAGFAQA 160
gi 45569503   81 AKRQDTIGAIDFDTLGKTSPATAALLADVEKAKIAHDNVDNMTGIESVLSSLGTAVKYLVSAPDQKNTLMGDIGAGFAQA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  161 NRGAAGLFQSVFELPNNLVGTILPANPLQPVADQFAQWGAQSKDLAKRLSPPQSDTLGSGVSSGVQSLTSNLLMLPLALL 240
gi 45580754  161 NRGAAGLFQSVFELPNNLVGTILPANPLQPVADQFAQWGAQSKDLAKRLSPPQSDTLGSGVSSGVQSLTSNLLMLPLALL 240
gi 45569503  161 NRGAAGLFQSVFELPNNLVGTILPANPLQPVADQFAQWGAQSKDLAKRLSPPQSDTLGSGVSSGVQSLTSNLLMLPLALL 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  241 PGGQPAALGGMASMTGGQSYQDARSQGLTPAQALPFAVSQATIEYATEKLPVSRLIGDLHAGSPLLKTLAHQVATEVPGE 320
gi 45580754  241 PGGQPAALGGMASMTGGQSYQDARSQGLTPAQALPFAVSQATIEYATEKLPVSRLIGDLHAGSPLLKTLAHQVATEVPGE 320
gi 45569503  241 PGGQPAALGGMASMTGGQSYQDARSQGLTPAQALPFAVSQATIEYATEKLPVSRLIGDLHAGSPLLKTLAHQVATEVPGE 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  321 QVATVLQDLNEWAVLPENKEKPFSAYLAERPSAAAQTLIATLVGVGGNVAVMRGIDRTITTADQRTQRAQAAQQQAELLA 400
gi 45580754  321 QVATVLQDLNEWAVLPENKEKPFSAYLAERPSAAAQTLIATLVGVGGNVAVMRGIDRTITTADQRTQRAQAAQQQAELLA 400
gi 45569503  321 QVATVLQDLNEWAVLPENKEKPFSAYLAERPSAAAQTLIATLVGVGGNVAVMRGIDRTITTADQRTQRAQAAQQQAELLA 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  401 RLNQLAAADKVLARDPDTFEQFVANAAENGPVQQVFIDANTLMQSGLAEQVAAVSPAVAAQLPEALQTGGQVAIPVEEYA 480
gi 45580754  401 RLNQLAAADKVLARDPDTFEQFVANAAENGPVQQVFIDANTLMQSGLAEQVAAVSPAVAAQLPEALQTGGQVAIPVEEYA 480
gi 45569503  401 RLNQLAAADKVLARDPDTFEQFVANAAENGPVQQVFIDANTLMQSGLAEQVAAVSPAVAAQLPEALQTGGQVAIPVEEYA 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  481 ARIAPTEATQGLLDHLKTEPEGFSRAEAQQYMQSQAEELRAEVERALGEQQGDDAFKQSAEAVRAAVKTQLDTAARFTPQ 560
gi 45580754  481 ARIAPTEATQGLLDHLKTEPEGFSRAEAQQYMQSQAEELRAEVERALGEQQGDDAFKQSAEAVRAAVKTQLDTAARFTPQ 560
gi 45569503  481 ARIAPTEATQGLLDHLKTEPEGFSRAEAQQYMQSQAEELRAEVERALGEQQGDDAFKQSAEAVRAAVKTQLDTAARFTPQ 560
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  561 VNDAYSSMVGNFYAVQAARLGTTPEALFQQYPLRVAAESVAGGQQFDQEHGPFGPVLRDFQGDAKGAIAKLLEMKSGEAI 640
gi 45580754  561 VNDAYSSMVGNFYAVQAARLGTTPEALFQQYPLRVAAESVAGGQQFDQEHGPFGPVLRDFQGDAKGAIAKLLEMKSGEAI 640
gi 45569503  561 VNDAYSSMVGNFYAVQAARLGTTPEALFQQYPLRVAAESVAGGQQFDQEHGPFGPVLRDFQGDAKGAIAKLLEMKSGEAI 640
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  641 GALHHPDIGDIDLVWGEEGTRRSDGYGLAKLAKWHPEVLDDLQGILSAMKVTSRTENRVNLESADHRAGVRLTWDDQAKH 720
gi 45580754  641 GALHHPDIGDIDLVWGEEGTRRSDGYGLAKLAKWHPEVLDDLQGILSAMKVTSRTENRVNLESADHRAGVRLTWDDQAKH 720
gi 45569503  641 GALHHPDIGDIDLVWGEEGTRRSDGYGLAKLAKWHPEVLDDLQGILSAMKVTSRTENRVNLESADHRAGVRLTWDDQAKH 720
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  721 WLLTAFQKKGGVAGTRTGTTDLFVEDGTARPDDASDAIVDQKIDKFYQGGGRARGTFDPATLTVSLLKNADLSTFLHESG 800
gi 45580754  721 WLLTAFQKKGGVAGTRTGTTDLFVEDGTARPDDASDAIVDQKIDKFYQGGGRARGTFDPATLTVSLLKNADLSTFLHESG 800
gi 45569503  721 WLLTAFQKKGGVAGTRTGTTDLFVEDGTARPDDASDAIVDQKIDKFYQGGGRARGTFDPATLTVSLLKNADLSTFLHESG 800
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  801 HFFLEVQLDIATRLAEKQRAGATLIDAETEVQRDAQTLLDWFGVRDLAAWNDLDFEAKRAHHEQFARGFEAYLFEGKAPS 880
gi 45580754  801 HFFLEVQLDIATRLAEKQRAGATLIDAETEVQRDAQTLLDWFGVRDLAAWNDLDFEAKRAHHEQFARGFEAYLFEGKAPS 880
gi 45569503  801 HFFLEVQLDIATRLAEKQRAGATLIDAETEVQRDAQTLLDWFGVRDLAAWNDLDFEAKRAHHEQFARGFEAYLFEGKAPS 880
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  881 IEMHGLFQRFRAWLLNVYRDLKALNVELTPEVRNVFDRMLATGEQIALAEQGRSMMPLFATAEQAGMTPEEFAAYQALGV 960
gi 45580754  881 IEMHGLFQRFRAWLLNVYRDLKALNVELTPEVRNVFDRMLATGEQIALAEQGRSMMPLFATAEQAGMTPEEFAAYQALGV 960
gi 45569503  881 IEMHGLFQRFRAWLLNVYRDLKALNVELTPEVRNVFDRMLATGEQIALAEQGRSMMPLFATAEQAGMTPEEFAAYQALGV 960
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371  961 DATNDAIQDLQARGLRDMQWLHNARGRIIKQLQKDAAARRADVRRQVAEEVNAQPVYRADRFLRYGELELPPGAPQNVRR 1040
gi 45580754  961 DATNDAIQDLQARGLRDMQWLHNARGRIIKQLQKDAAARRADVRRQVAEEVNAQPVYRADRFLRYGELELPPGAPQNVRR 1040
gi 45569503  961 DATNDAIQDLQARGLRDMQWLHNARGRIIKQLQKDAAARRADVRRQVAEEVNAQPVYRADRFLRYGELELPPGAPQNVRR 1040
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1041 AAEQANVDGAKLSLPALKEMYGEGENAIWRYLPTGKNGLAASEGMHPDTVAELFGFTSGDELVRRLLEAPPRGEEIEALT 1120
gi 45580754 1041 AAEQANVDGAKLSLPALKEMYGEGENAIWRYLPTGKNGLAASEGMHPDTVAELFGFTSGDELVRRLLEAPPRGEEIEALT 1120
gi 45569503 1041 AAEQANVDGAKLSLPALKEMYGEGENAIWRYLPTGKNGLAASEGMHPDTVAELFGFTSGDELVRRLLEAPPRGEEIEALT 1120
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1121 DVRMLEQFGELSTPEAIERAADSAIHNDARARFVATEANALARVAAGPTQQIGTDRRGRPIVRRVLPEAAREYARALVSR 1200
gi 45580754 1121 DVRMLEQFGELSTPEAIERAADSAIHNDARARFVATEANALARVAAGPTQQIGTDRRGRPIVRRVLPEAAREYARALVSR 1200
gi 45569503 1121 DVRMLEQFGELSTPEAIERAADSAIHNDARARFVATEANALARVAAGPTQQIGTDRRGRPIVRRVLPEAAREYARALVSR 1200
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1201 LKVRDIRPGQYTNAEVRAARNADRAMKAGDLATAAAEKRNQLIQHQAARAAYDAQDEVERGLRYLGKFAGDIKGIDVDYA 1280
gi 45580754 1201 LKVRDIRPGQYTNAEVRAARNADRAMKAGDLATAAAEKRNQLIQHQAARAAYDAQDEVERGLRYLGKFAGDIKGIDVDYA 1280
gi 45569503 1201 LKVRDIRPGQYTNAEVRAARNADRAMKAGDLATAAAEKRNQLIQHQAARAAYDAQDEVERGLRYLGKFAGDIKGIDVDYA 1280
                       1290      1300      1310      1320      1330      1340      1350      1360
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1281 DQIANLLERFDLRKGQSLKAVDKRTALADWLRSQREAGFEPDIPAELENEAYRTSYKNMTVEEFRGLVDSVRQIEHLGRL 1360
gi 45580754 1281 DQIANLLERFDLRKGQSLKAVDKRTALADWLRSQREAGFEPDIPAELENEAYRTSYKNMTVEEFRGLVDSVRQIEHLGRL 1360
gi 45569503 1281 DQIANLLERFDLRKGQSLKAVDKRTALADWLRSQREAGFEPDIPAELENEAYRTSYKNMTVEEFRGLVDSVRQIEHLGRL 1360
                       1370      1380      1390      1400      1410      1420      1430      1440
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1361 KRKLLTAADQRDYEAVRDEIAGSIRAHAQGRSADTRTPTTNAGRAVQGLKRFWASHIKAATWARVMDGGKDGGPMWEYFV 1440
gi 45580754 1361 KRKLLTAADQRDYEAVRDEIAGSIRAHAQGRSADTRTPTTNAGRAVQGLKRFWASHIKAATWARVMDGGKDGGPMWEYFV 1440
gi 45569503 1361 KRKLLTAADQRDYEAVRDEIAGSIRAHAQGRSADTRTPTTNAGRAVQGLKRFWASHIKAATWARVMDGGKDGGPMWEYFV 1440
                       1450      1460      1470      1480      1490      1500      1510      1520
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1441 RSANERGDMETTMRAEATGKLSEILAPVFALGKMGGKGQHFPTIGRSLNREARLTIALNMGNEGNIQRLLGGEGWTPAQI 1520
gi 45580754 1441 RSANERGDMETTMRAEATGKLSEILAPVFALGKMGGKGQHFPTIGRSLNREARLTIALNMGNEGNIQRLLGGEGWTPAQI 1520
gi 45569503 1441 RSANERGDMETTMRAEATGKLSEILAPVFALGKMGGKGQHFPTIGRSLNREARLTIALNMGNEGNIQRLLGGEGWTPAQI 1520
                       1530      1540      1550      1560      1570      1580      1590      1600
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1521 APVLQSLTAQEWQAVQAVWDHFEGYRPQIAAKERRVYGKEPAWVEPRPLTITTADGQTLTLRGGYYPIKYDPAASQRAEE 1600
gi 45580754 1521 APVLQSLTAQEWQAVQAVWDHFEGYRPQIAAKERRVYGKEPAWVEPRPLTITTADGQTLTLRGGYYPIKYDPAASQRAEE 1600
gi 45569503 1521 APVLQSLTAQEWQAVQAVWDHFEGYRPQIAAKERRVYGKEPAWVEPRPLTITTADGQTLTLRGGYYPIKYDPAASQRAEE 1600
                       1610      1620      1630      1640      1650      1660      1670      1680
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1601 HSDAESARRQLQGAYTTATTRRSFTKSRVEEVSGRPLLYTLSGLYSGVNDVIHDLAWHEWLIDANRLLRSQTIDGAIREH 1680
gi 45580754 1601 HSDAESARRQLQGAYTTATTRRSFTKSRVEEVSGRPLLYTLSGLYSGVNDVIHDLAWHEWLIDANRLLRSQTIDGAIREH 1680
gi 45569503 1601 HSDAESARRQLQGAYTTATTRRSFTKSRVEEVSGRPLLYTLSGLYSGVNDVIHDLAWHEWLIDANRLLRSQTIDGAIREH 1680
                       1690      1700      1710      1720      1730      1740      1750      1760
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1681 YGPEAKQQFKTWAADIAEGERGADAAVDIALSRLRQGVSASGLGFNVMSALMQPLGITQSIVRVGAPWVGRGVMKYLAAP 1760
gi 45580754 1681 YGPEAKQQFKTWAADIAEGERGADAAVDIALSRLRQGVSASGLGFNVMSALMQPLGITQSIVRVGAPWVGRGVMKYLAAP 1760
gi 45569503 1681 YGPEAKQQFKTWAADIAEGERGADAAVDIALSRLRQGVSASGLGFNVMSALMQPLGITQSIVRVGAPWVGRGVMKYLAAP 1760
                       1770      1780      1790      1800      1810      1820      1830      1840
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1761 VGLTREINAKSSFMANRARTRFRELNELRNQVQDGSATKEWVGRNAYFLMMRCQQMVDVPTWWGAYEKAVAEGNDETRAV 1840
gi 45580754 1761 VGLTREINAKSSFMANRARTRFRELNELRNQVQDGSATKEWVGRNAYFLMMRCQQMVDVPTWWGAYEKAVAEGNDETRAV 1840
gi 45569503 1761 VGLTREINAKSSFMANRARTRFRELNELRNQVQDGSATKEWVGRNAYFLMMRCQQMVDVPTWWGAYEKAVAEGNDETRAV 1840
                       1850      1860      1870      1880      1890      1900      1910      1920
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1841 SLADQAVIDSQGGGQTKDLSAIERGGPAQRLFTVFYSFMNTALNIGVAQTMSADTPAKRAKLAADYAMLYVVPAVLGYFL 1920
gi 45580754 1841 SLADQAVIDSQGGGQTKDLSAIERGGPAQRLFTVFYSFMNTALNIGVAQTMSADTPAKRAKLAADYAMLYVVPAVLGYFL 1920
gi 45569503 1841 SLADQAVIDSQGGGQTKDLSAIERGGPAQRLFTVFYSFMNTALNIGVAQTMSADTPAKRAKLAADYAMLYVVPAVLGYFL 1920
                       1930      1940      1950      1960      1970      1980      1990      2000
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179371 1921 KDALTPGDSGDDDPEKLAKKLLANQIDYLMGLMVVVREFGEAAKTVTGANDMGRDYTGPAGLRLIADVGRFATQTHQGEF 2000
gi 45580754 1921 KDALTPGDSGDDDPEKLAKKLLANQIDYLMGLMVVVREFGEAAKTVTGANDMGRDYTGPAGLRLIADVGRFATQTHQGEF 2000
gi 45569503 1921 KDALTPGDSGDDDPEKLAKKLLANQIDYLMGLMVVVREFGEAAKTVTGANDMGRDYTGPAGLRLIADVGRFATQTHQGEF 2000
                       2010      2020      2030      2040      2050
                 ....*....|....*....|....*....|....*....|....*....|..
gi 41179371 2001 DDAFRKAAVNVVGDLFGLPSAQINRTVTGVQALAEGKTQNPAAIGFGFQEAR 2052
gi 45580754 2001 DDAFRKAAVNVVGDLFGLPSAQINRTVTGVQALAEGKTQNPAAIGFGFQEAR 2052
gi 45569503 2001 DDAFRKAAVNVVGDLFGLPSAQINRTVTGVQALAEGKTQNPAAIGFGFQEAR 2052
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap