Conserved Protein Domain Family
PHA00658

?
PHA00658: PHA00658 
putative lysin
Statistics
?
PSSM-Id: 106967
View PSSM: PHA00658
Aligned: 3 rows
Threshold Bit Score: 1470.82
Threshold Setting Gi: 41179372
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179372   1 MPRVPVYDSPQVSPNTVPQARLATPSFATPTFRGADAPAFQDTANQQARQFSQGARQFSNDVGRIADSMVQQANQLRVDD 80
gi 45580755   1 MPRVPVYDSPQVSPNTVPQARLATPSFATPTFRGADAPAFQDTANQQARQFSQGARQFSNDVGRIADSMVQQANQLRVDD 80
gi 45569504   1 MPRVPVYDSPQVSPNTVPQARLATPSFATPTFRGADAPAFQDTANQQARQFSQGARQFSNDVGRIADSMVQQANQLRVDD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179372  81 ALNRAKEAALRLTYDKDTGFANLKGINALERPEGKPLADEYGDNLKKQLDEISGTLGNDAQRRAFALHSNDILTSFRGQA 160
gi 45580755  81 ALNRAKEAALRLTYDKDTGFANLKGINALERPEGKPLADEYGDNLKKQLDEISGTLGNDAQRRAFALHSNDILTSFRGQA 160
gi 45569504  81 ALNRAKEAALRLTYDKDTGFANLKGINALERPEGKPLADEYGDNLKKQLDEISGTLGNDAQRRAFALHSNDILTSFRGQA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179372 161 VQHEASEYKTYALSTSEGIQSTALRDIALNWNNPDAINSAVDRIKAETFRQAQLLGKSAEWQEAQARKLTSNAHKIALMS 240
gi 45580755 161 VQHEASEYKTYALSTSEGIQSTALRDIALNWNNPDAINSAVDRIKAETFRQAQLLGKSAEWQEAQARKLTSNAHKIALMS 240
gi 45569504 161 VQHEASEYKTYALSTSEGIQSTALRDIALNWNNPDAINSAVDRIKAETFRQAQLLGKSAEWQEAQARKLTSNAHKIALMS 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179372 241 ALEQNNPTYASAYLNKYSGQMDADDILTVRGHITKDMDGRAGLAAATDAVGKVPIQVSDGERAFNIAVGTESGGRQFGAD 320
gi 45580755 241 ALEQNNPTYASAYLNKYSGQMDADDILTVRGHITKDMDGRAGLAAATDAVGKVPIQVSDGERAFNIAVGTESGGRQFGAD 320
gi 45569504 241 ALEQNNPTYASAYLNKYSGQMDADDILTVRGHITKDMDGRAGLAAATDAVGKVPIQVSDGERAFNIAVGTESGGRQFGAD 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179372 321 GKPLTSPKGAVGIAQVMPDTAPEAAKLAGLPWDENRYRNDAAYNRALGMAYFQKQLRDFGGDLPKAYAAYNAGPGALQSA 400
gi 45580755 321 GKPLTSPKGAVGIAQVMPDTAPEAAKLAGLPWDENRYRNDAAYNRALGMAYFQKQLRDFGGDLPKAYAAYNAGPGALQSA 400
gi 45569504 321 GKPLTSPKGAVGIAQVMPDTAPEAAKLAGLPWDENRYRNDAAYNRALGMAYFQKQLRDFGGDLPKAYAAYNAGPGALQSA 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179372 401 LKDAKDGNWLALLPKETQDYVVKNMQAYNAGQGRPARPTLADIEAQLQNDPRLAGNPERLKIARVEAERQFNMQTAALKQ 480
gi 45580755 401 LKDAKDGNWLALLPKETQDYVVKNMQAYNAGQGRPARPTLADIEAQLQNDPRLAGNPERLKIARVEAERQFNMQTAALKQ 480
gi 45569504 401 LKDAKDGNWLALLPKETQDYVVKNMQAYNAGQGRPARPTLADIEAQLQNDPRLAGNPERLKIARVEAERQFNMQTAALKQ 480
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179372 481 RDDEAVATALRGLYENGGRFSELPVSIRANIPPEKLTSVMGAAERIAKGDDTTSLWLYNKLTNSPDELARMSDNEFYALR 560
gi 45580755 481 RDDEAVATALRGLYENGGRFSELPVSIRANIPPEKLTSVMGAAERIAKGDDTTSLWLYNKLTNSPDELARMSDNEFYALR 560
gi 45569504 481 RDDEAVATALRGLYENGGRFSELPVSIRANIPPEKLTSVMGAAERIAKGDDTTSLWLYNKLTNSPDELARMSDNEFYALR 560
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179372 561 TSLSEADFKHFSQERAKRLGAAPSTNGPGDLNSQAIKAGLDTRLRMMGDDPTPKDGSSDAERVGAMRKFIDGYFIAAQRE 640
gi 45580755 561 TSLSEADFKHFSQERAKRLGAAPSTNGPGDLNSQAIKAGLDTRLRMMGDDPTPKDGSSDAERVGAMRKFIDGYFIAAQRE 640
gi 45569504 561 TSLSEADFKHFSQERAKRLGAAPSTNGPGDLNSQAIKAGLDTRLRMMGDDPTPKDGSSDAERVGAMRKFIDGYFIAAQRE 640
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41179372 641 AGKKFTDAEVEQHLDALFMKNATVRGWFSNSSVPILSMKVGDIDSATKDGIKAAYKRAGIDSPTDAQILNAYWNLKVSRK 720
gi 45580755 641 AGKKFTDAEVEQHLDALFMKNATVRGWFSNSSVPILSMKVGDIDSATKDGIKAAYKRAGIDSPTDAQILNAYWNLKVSRK 720
gi 45569504 641 AGKKFTDAEVEQHLDALFMKNATVRGWFSNSSVPILSMKVGDIDSATKDGIKAAYKRAGIDSPTDAQILNAYWNLKVSRK 720
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap