Conserved Protein Domain Family
PHA00661

?
PHA00661: PHA00661 
hypothetical protein
Statistics
?
PSSM-Id: 106970
View PSSM: PHA00661
Aligned: 6 rows
Threshold Bit Score: 1126.18
Threshold Setting Gi: 45580757
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30387391   1 MAFSWIQPSFAGGEIGPSLYGRIDMSKYQVALRKCDNFIVRQYGGVENRPGTRFVGPAKYPDRKCRLIPFQFSTVQTYAL 80
gi 48697202   2 PKAAPQQVSFDAGELSPLLGARVDLAKYPNGCQVMENFIATVQGPAIRRGGKRFVAATKDSTKQSWLLPFIVADGIAYML 81
gi 45580757   2 SNVRVLQRSFGGGEISPEMFGRIDDVKYQSGLAICRNFVVKPQGPAENRAGFAFVREVKDSAKKVRLIPFTYSVTQTMVI 81
gi 89152436   1 MAISWIQPSFAGGEIGPSLYGRIDMAKYQVALRKCDNFIVRQYGGVENRPGTRFVGAAKYPNRKCRLIPFQFSTVQTYAL 80
gi 41179374   2 SNVRVLQRSFGGGEISPEMFGRIDDVKYQSGLAICRNFVVKPQGPAENRAGFAFVREVKDSAKKVRLIPFTYSVTQTMVI 81
gi 45569506   2 SNVRVLQRSFGGGEISPEMFGRIDDVKYQSGLAICRNFVVKPQGPAENRAGFAFVREVKDSAKKVRLIPFTYSVTQTMVI 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30387391  81 EFGHNYMRVIKDGAYVLTTSnVIYELAMPYADTDL------FRIKFTQSADVLTLVHPAYPPKELRRYAHDNWQIVDVTT 154
gi 48697202  82 EFGDHYIRFFVNRGQLVNAG-APVEIATPYALADLttedgtFAIRATQSADTMYLFHGGYPTQKLLRTSATTFSLQPVTF 160
gi 45580757  82 ELGAGYFRFHTNGGTLLDGA-VPYEIANPYAEADL------FNIHYVQSADVLTLVHPNYAPRELRRLGATNWQLATIAF 154
gi 89152436  81 EFGHQYMRVIKDGALVLNSSnVIYEIATPYTEADL------FRIKFTQSADVLTLVHPAYPPKELRRYAHDNWQLVDVVT 154
gi 41179374  82 ELGAGYFRFHTNGGTLLDGA-VPYEIANPYAEADL------FNIHYVQSADVLTLVHPNYAPRELRRLGATNWQLATIAF 154
gi 45569506  82 ELGAGYFRFHTNGGTLLDGA-VPYEIANPYAEADL------FNIHYVQSADVLTLVHPNYAPRELRRLGATNWQLATIAF 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30387391 155 KNGPFEDINVDETVKVYASASTGTITLTASSAIFGAEQVGKLFYLEQPAVDSVPVWETSKTTAINDVRRADSNYYRANTS 234
gi 48697202 161 VGGPFAAVNSDNNVRVHASAGTGAVTLVASASVFRPSDVGTLFYLEQEDNSFVKPWVVHQKIGPSELRRVGDRVYLCTAV 240
gi 45580757 155 TS------PVATPTSVTATSNNKGTDYTYRYVVTALDAEGK------------------TESAPSSAGTCTNNLFTNGGA 210
gi 89152436 155 KNGPFEDINIDESLTVYASASTGTITLTASASIFGAEQVGKLFYLEQPAVDSVPVWETSKSTSIGDIRRADSNYYRAVTA 234
gi 41179374 155 TS------PVATPTSVTATSNNKGTDYTYRYVVTALDAEGK------------------TESAPSSAGTCTNNLFTNGGA 210
gi 45569506 155 TS------PVATPTSVTATSNNKGTDYTYRYVVTALDAEGK------------------TESAPSSAGTCTNNLFTNGGA 210
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30387391 235 GKT-----GTLRPSHTEGMSWDGWG-GTGS----DDTGIQWEYLHSGFGIAKI-----TAVAGDGLTATADVVSFIPSQV 299
gi 48697202 241 GTAtpqvtGTETPTHTSGSRWDGTGqDESAtdeyGSIGAEWEYQHSGYGTVLItgytnDQVVTGTVATNDPADPGMLPNT 320
gi 45580757 211 NTI----------------AWSASS-GASRynvyKEQGGLYGYIGQTTGTSLV-----DDNIAPDLSVTPPIYDAV---- 264
gi 89152436 235 GKT-----GTLRPSHTEGTSWDGWG-GSGD----DDTGIEWEYLHSGFGIARI-------TAVNGTTATAEVISYIPSQV 297
gi 41179374 211 NTI----------------AWSASS-GASRynvyKEQGGLYGYIGQTTGTSLV-----DDNIAPDLSVTPPIYDAV---- 264
gi 45569506 211 NTI----------------AWSASS-GASRynvyKEQGGLYGYIGQTTGTSLV-----DDNIAPDLSVTPPIYDAV---- 264
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30387391 300 VGSANASYKWAKYAWNSVNGYPSTVVYYQQRLYFAastaypQTIWASRTGDYKDFGKNN----PIQDDDRIIYTYAGRQV 375
gi 48697202 321 VVTLTGTYKWARSLFNSTDGFPQMGTFWRNRLCLM------RDRWLAMSVSADFETFKTkdadQQTDDSAIVQQLNARQL 394
gi 45580757 265 --------------FNAAGDYPAAVSYFEQRRCFAgttnkpQNIWMTRSGTESAMSYSL----PVRDDDRVAFRVAAREA 326
gi 89152436 298 VGEDNASYKWAKYAWNSVNGYPGTVVYYQQRLYFAastafpQTIWASRTGDYKDFGKSN----PTQDDDRIIYTYAGRQV 373
gi 41179374 265 --------------FNAAGDYPAAVSYFEQRRCFAgttnkpQNIWMTRSGTESAMSYSL----PVRDDDRVAFRVAAREA 326
gi 45569506 265 --------------FNAAGDYPAAVSYFEQRRCFAgttnkpQNIWMTRSGTESAMSYSL----PVRDDDRVAFRVAAREA 326
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30387391 376 NEIRHLIDVGNLVALTSGGEYTISGDQ-NKVLTPSAFSFSSQGNNGSSNVPPIAVANIALFIQEKGSVVRDLAYSFDVDG 454
gi 48697202 395 NKLAWMVESDSLLIGMTGDEWVIGPANaSQPVSAANLNAARRTSYGSKRIQPVQVGGTIMFVQKAGRKLRDFKYDFSSDN 474
gi 45580757 327 NAIRHIVPLTELLLLTSSGEWRVASVN-SDAVTPTTISVRPQSYVGATDVQPVVVNNTTIYGAARGGHVRELAYNWQANG 405
gi 89152436 374 NEIRHLIDVGSLVALTSGGEYVITGDQ-NKVLTPSSFAFSSQGSNGSSNVPPIAVANIALFVQEKGSVVRDLAYSFDVDG 452
gi 41179374 327 NAIRHIVPLTELLLLTSSGEWRVASVN-SDAVTPTTISVRPQSYVGATDVQPVVVNNTTIYGAARGGHVRELAYNWQANG 405
gi 45569506 327 NAIRHIVPLTELLLLTSSGEWRVASVN-SDAVTPTTISVRPQSYVGATDVQPVVVNNTTIYGAARGGHVRELAYNWQANG 405
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30387391 455 YQGTDLTILANHLF-----QKHSIVDWSFCIVPYSSAFCIRDDGKLLVLTYLRD---QQVFAWAPQSSAGKYESTCS--- 523
gi 48697202 475 YVSTDVTKIADHITrgragTNSGIMSLCFQQEPHSVVWAARADGQLIGCTYDEEagrSDVYGWHRHPDANGFVECVAsmp 554
gi 45580757 406 FVTGDLSLRAAHLF-----DNLDILDMAYAKAPQPIVWFISSSGKLLGLTYVPE---QQIGAWHQHDTDGVFESCAV--- 474
gi 89152436 453 YQGNDLTILANHLF-----QKHSIVDWCFSIVPYSSAFCIRDDGKLLVMTYLRD---QQVFAWAPQSSTGKYESTCS--- 521
gi 41179374 406 FVTGDLSLRAAHLF-----DNLDILDMAYAKAPQPIVWFISSSGKLLGLTYVPE---QQIGAWHQHDTDGVFESCAV--- 474
gi 45569506 406 FVTGDLSLRAAHLF-----DNLDILDMAYAKAPQPIVWFISSSGKLLGLTYVPE---QQIGAWHQHDTDGVFESCAV--- 474
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30387391 524 ISEGSEDAVYFVVNRTINGQTVRYIERLSSRLFT--NDEDAFFVDCGLSYDGRNTSSrtmtisggtgdwsyqvdypvtvs 601
gi 48697202 555 APDGASDDLWVIVRRQVNGQTVRYVEYLNPALQDdePQSSAFYVDAGITYNGVPTST----------------------- 611
gi 45580757 475 VAEGNEDRLYAVVRRTIGGNEVRYVERMASRQFD--AQADAFFVDSGLTYSGEPVSH----------------------- 529
gi 89152436 522 ISEGNEDAVYFVVNRTVNGQTVRYIERLSSRLFT--SDEDAFFVDSGLSYDGRNTSDrtmtitggsgewdylaeytisvs 599
gi 41179374 475 VAEGNEDRLYAVVRRTIGGNEVRYVERMASRQFD--AQADAFFVDSGLTYSGEPVSH----------------------- 529
gi 45569506 475 VAEGNEDRLYAVVRRTIGGNEVRYVERMASRQFD--AQADAFFVDSGLTYSGEPVSH----------------------- 529
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30387391 602 ggayfvntdvgaqiqfpytgtdpdtnepvakelrgdiisvtsntavvvrfnrnvppvlrnvattnwqmarqtFSGLAHLE 681
gi 48697202 612 ------------------------------------------------------------------------IAGLGHLE 619
gi 45580757 530 ------------------------------------------------------------------------ISGLEHLE 537
gi 89152436 600 ggayftssdvgaqlqfpytgadpdtgyevskelrcdiisvtsntavvvranrnvppslrnvattnwqmarrtFGGLSHLE 679
gi 41179374 530 ------------------------------------------------------------------------ISGLEHLE 537
gi 45569506 530 ------------------------------------------------------------------------ISGLEHLE 537
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30387391 682 GQTVNILSDASVEPQKTVTGGAVTLESPGAVVHIGLPITAEFETLDININGQETL-LDKKQVIPTVTMVVNASRGIWATT 760
gi 48697202 620 GVTVAVLTDGAVHPSRTVTAGAITLDWSASIVHIGVPTTCRIQTMQLNAGAANGTaQGKTKRVTNIATRFSRSLGGVVGP 699
gi 45580757 538 GKTVSILADGAVHPQRVVTDGAIDLDVEAGTVHIGLPITAELQTLPVAMQLDGSFgQGRVKNINKLWLRVHRSSGIFAGP 617
gi 89152436 680 GQTVNILSDANVEPQKVVSGGAVTLESPGAVVHIGLPITAEFETLDININGQETL-LDKKQVIPSVTLVVNASRGIWATT 758
gi 41179374 538 GKTVSILADGAVHPQRVVTDGAIDLDVEAGTVHIGLPITAELQTLPVAMQLDGSFgQGRVKNINKLWLRVHRSSGIFAGP 617
gi 45569506 538 GKTVSILADGAVHPQRVVTDGAIDLDVEAGTVHIGLPITAELQTLPVAMQLDGSFgQGRVKNINKLWLRVHRSSGIFAGP 617
                       810       820       830       840       850       860       870
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 30387391 761 PGGTwyeyPQREFEFYDDPVDDATGKVEVK---LDSNW--DKNGRVKV--RQLDPLPLSVLAVLPRLTVGGF 825
gi 48697202 700 TFDD----NDLEQLSFRKPSNAMDRAVPLFdgdMESDWrgGYEGQSWIcyQNDQPLPVTLLGFFPILDTQDD 767
gi 45580757 618 HADAltevKQRTSEPYGSPPALKSEEIPLV---LSPKW--GDSGQLFV--RQADPLPLMIVSMSAEIAIGA- 681
gi 89152436 759 PGGKwyeyPQREFEFYDDPVDDATGKVEVK---LDSNW--GKNGRVKI--RQLDPLPLSVLAVIPRLTVGGF 823
gi 41179374 618 HADAltevKQRTSEPYGSPPALKSEEIPLV---LSPKW--GDSGQLFV--RQADPLPLMIVSMSAEIAIGA- 681
gi 45569506 618 HADAltevKQRTSEPYGSPPALKSEEIPLV---LSPKW--GDSGQLFV--RQADPLPLMIVSMSAEIAIGA- 681
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap