Conserved Protein Domain Family
PHA00663

?
PHA00663: PHA00663 
hypothetical protein
Statistics
?
PSSM-Id: 106972
View PSSM: PHA00663
Aligned: 3 rows
Threshold Bit Score: 115.289
Threshold Setting Gi: 45580759
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 45580759  1 MEVIALKQGYFGKLREPGDKFDVPDGAKASWFAPASAAQHAPRAGKAPKQPADKNPQGSDDKSGGDLV 68
gi 41179376  1 MEVIALKQGYFGKLREPGDKFDVPDGAKASWFAPASAAQHAPRAGKAPKQPADKNPQGSDDKSGGDLV 68
gi 45569508  1 MEVIALKQGYFGKLREPGDKFDVPDGAKASWFAPASAAQHAPRAGKAPKQPADKNPQGSDDKSGGDLV 68
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap