Conserved Protein Domain Family
PHA00664

?
PHA00664: PHA00664 
hypothetical protein
Statistics
?
PSSM-Id: 106973
View PSSM: PHA00664
Aligned: 6 rows
Threshold Bit Score: 153.133
Threshold Setting Gi: 30387387
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89152432   1 MITDKLLMFSEAQAVTNTAASTDVIDLGPIDgkrRDIGVGYPLEFWALVNEAATASGEATVNIQLQTSENNSSWTTIYDS 80
gi 41179377   1 MIIDKLLQVSDGQAVTASAASTDVIDFGQAN---PNTGMDDRSKMVITVDESADAAGAATVTFSVQDSADNATFADVAAT 77
gi 48697199   1 MYIDSLLEFSRAQALSASGASTNIIDLGSDR----DIGPGRPLWVVVSPSVAADNTTGDETYSIALQTDDNAAFSSPTTI 76
gi 45569509   1 MIIDKLLQVSDGQAVTASAASTDVIDFGQAN---PNTGMDDRSKMVITVDESADAAGAATVTFSVQDSADNATFADVAAT 77
gi 45580760   1 MIIDKLLQVSDGQAVTASAASTDVIDFGQAN---PNTGMDDRSKMVITVDESADAAGAATVTFSVQDSADNATFADVAAT 77
gi 30387387   1 MLLDQQALFSAAQAITATAVSTNVIDTGSSK----DVGKYGDIPLLIQVVEAFNTLTSLTVTV---QTDDNSSFSSATDV 73
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 89152432  81 GAL--AKTALTAGKRVvSAKVPAGVQRYLRVNYSVATGPLTAGEFTAGISLDVDANTPYPIRSKVT 144
gi 41179377  78 GAI--GKANLAAGKQV-VIPMPTKLRRYCRVYYTVATGPLTAGKFSAQVVTGIQQNVAYPDSPRIA 140
gi 48697199  77 ATVapAAASFGAGVRV-VIGMPFANERYLRLNYTLGG---TTPSVTLNAFLTDQDPASWQAYPDGI 138
gi 45569509  78 GAI--GKANLAAGKQV-VIPMPTKLRRYCRVYYTVATGPLTAGKFSAQVVTGIQQNVAYPDSPRIA 140
gi 45580760  78 GAI--GKANLAAGKQV-VIPMPTKLRRYCRVYYTVATGPLTAGKFSAQVVTGIQQNVAYPDSPRIA 140
gi 30387387  74 ISMviPLASLTVGYKTpVITLPMKLERYIRLNYTVTGTAPTTGKVTAGIVGGVQTNV--------- 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap