Conserved Protein Domain Family
PHA00665

?
PHA00665: PHA00665 
major capsid protein
Statistics
?
PSSM-Id: 106974
View PSSM: PHA00665
Aligned: 6 rows
Threshold Bit Score: 599.942
Threshold Setting Gi: 30387386
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45569510   1 MPTLSTTNPTLADVAARMTPDGKIDpQIVEMLNETNEILDDMTVIEANGFTEHKTTVRSGLPTGTWRKLNYGVQPEKSRT 80
gi 48697198   1 MATLSTNNPTMADVAKRLDPNGKVD-IIVEMLNQTNPVLQDMTAIEGNLPTGHRTSVRTGLPTPTWRKLYGGVLPNKSST 79
gi 89152431   1 MAVKGLTALTLADWGKRVDPNGKVD-KIIELLGQTNPILQDMPFVEGNLPTGHRTTIRSGLPSATWRLLNYGVQPSKSTT 79
gi 41179378   1 MPTLSTTNPTLADVAARMTPDGKIDpQIVEMLNETNEILDDMTVIEANGFTEHKTTVRSGLPTGTWRKLNYGVQPEKSRT 80
gi 30387386   1 MALIGQTLPSLLDIYNRTDKNGRIA-RIVEQLAKTNDILTDAIYVPCNDGSKHKTTIRAGIPEPVWRRYNQGVQPTKTQT 79
gi 45580761   1 MPTLSTTNPTLADVAARMTPDGKIDpQIVEMLNETNEILDDMTVIEANGFTEHKTTVRSGLPTGTWRKLNYGVQPEKSRT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45569510  81 VQVKDSMGMLETYAEVDKALADLNGNSAAWRLSEDRAFIEGMNQTQATTLFYGDSSIDAEKFMGLTPRFNSLS---AENG 157
gi 48697198  80 AQVTDNCGMLEAYAEVDKALADLNGNTAAFRLSEDRAQIEGMNQEVAQTLFYGNDGIAPAEFTGLSPRYNSLS---AENK 156
gi 89152431  80 VQVTDSVGMLETYAEVDKSLADLNGNTAEFRLSEDRAFIEAMNQQMAQTLFYGDSSVNPQQFMGLSSRYSSLS---AGNA 156
gi 41179378  81 VQVKDSMGMLETYAEVDKALADLNGNSAAWRLSEDRAFIEGMNQTQATTLFYGDSSIDAEKFMGLTPRFNSLS---AENG 157
gi 30387386  80 VPVTDTTGMLYDLGFVDKALADRSNNAAAFRVSENMGKLQGFNNKVARYSIYGNTDAEPEAFMGLAPRFNTLStskAASA 159
gi 45580761  81 VQVKDSMGMLETYAEVDKALADLNGNSAAWRLSEDRAFIEGMNQTQATTLFYGDSSIDAEKFMGLTPRFNSLS---AENG 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45569510 158 QNIIDAGGTGSDNASIWLTVWGPNTLHTIYPKGSQAGLQSRDLGEDTL--IDAAGGRYQGYRTHYKWDIGLTLRDWRYVV 235
gi 48697198 157 DNVIDAGGTGSDNASAWLVVWGPNTCHSIYPKGSKAGLSVEDKGQVTIenADGNGGRMEGYRTHYKWDIGLTLRDWRYVA 236
gi 89152431 157 QNIIDAGGTGTDNTSIWLVVWGENTVHGIFPKGKKAGIQMEDKGQVTL--EDANGGKYEGYRTHYKWDNGLALRDWRYVV 234
gi 41179378 158 QNIIDAGGTGSDNASIWLTVWGPNTLHTIYPKGSQAGLQSRDLGEDTL--IDAAGGRYQGYRTHYKWDIGLTLRDWRYVV 235
gi 30387386 160 ENVFSAGGSGSTNTSIWFMSWGENTAHMIYPEGMVAGFQHEDLGDDLV--SDGNGGQFRAYRDEFKWDIGLSVRDWRSIS 237
gi 45580761 158 QNIIDAGGTGSDNASIWLTVWGPNTLHTIYPKGSQAGLQSRDLGEDTL--IDAAGGRYQGYRTHYKWDIGLTLRDWRYVV 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45569510 236 RIANVDVSELTKNASAGAdLIDLMTQA--VELIPNVGMGRPAFYMPRKIRSFLRRQITNKVAAStLTMEEIAGKKVVAFD 313
gi 48697198 237 RVCNIDVSDLATSANAQA-LIKYMIMA--AERIPQLGMGRAVWYMNRNLREKLRLGIVDKIANN-LTWETVSGERVMTFD 312
gi 89152431 235 RIANIDVSNLSEPSSA-AnIAKLMVKA--LHRIPNRGMGRPVFYMNRTVGQALDLQSLEKTSLA-ISVKETEGEWWTSFR 310
gi 41179378 236 RIANVDVSELTKNASAGAdLIDLMTQA--VELIPNVGMGRPAFYMPRKIRSFLRRQITNKVAAStLTMEEIAGKKVVAFD 313
gi 30387386 238 RICNIDVTTLTKDASTGAdLISMMVDAyyARDVAMLGDGKEVIYANKTIHAWLHKQAMNAKNVN-LTIEEYGGKKIVSFL 316
gi 45580761 236 RIANVDVSELTKNASAGAdLIDLMTQA--VELIPNVGMGRPAFYMPRKIRSFLRRQITNKVAAStLTMEEIAGKKVVAFD 313
                       330
                ....*....|....*...
gi 45569510 314 GIPCRRTDALLLTEARVV 331
gi 48697198 313 GIPVQRTDALLNTESRVV 330
gi 89152431 311 GVPIRETDALLETEARVV 328
gi 41179378 314 GIPCRRTDALLLTEARVV 331
gi 30387386 317 GIPIRRVDAILNTESAVT 334
gi 45580761 314 GIPCRRTDALLLTEARVV 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap