Conserved Protein Domain Family
PHA00670

?
PHA00670: PHA00670 
hypothetical protein
Statistics
?
PSSM-Id: 106978
View PSSM: PHA00670
Aligned: 8 rows
Threshold Bit Score: 761.313
Threshold Setting Gi: 48697195
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696684   1 MENSKIVKRL----DFLKTDRKNVEQIWDCIRKYIMPMRSDFFSDLRSEGSinwNQNREVFDSTAGDGLETLSSSLHGSL 76
gi 45569514   5 TERKLLLSRW----GQLRTERESWMSHWKEISDYLLPRAGRFFVQDRNRGE---KRHNNILDNTGTRALRVLAAGMMAGM 77
gi 48697195   3 NDDAKILQALnadhGRMKEKRQSYEAVWNDVIDYLMPRLDKFGQLPRPDSEkgrERSQKMFDSTAPLALRNFVAAMDSMI 82
gi 30387383   4 TEKERLLKQL----AQLKNERTSFESHWLDLSDFINPRGSRFLTSDVNRDD---RRNTKIVDPTGSMAQRILSSGMMSGI 76
gi 45580765   5 TERKLLLSRW----GQLRTERESWMSHWKEISDYLLPRAGRFFVQDRNRGE---KRHNNILDNTGTRALRVLAAGMMAGM 77
gi 41179382   5 TERKLLLSRW----GQLRTERESWMSHWKEISDYLLPRAGRFFVQDRNRGE---KRHNNILDNTGTRALRVLAAGMMAGM 77
gi 89152428   4 TTKERLNKQF----AQLESERQSFEPHWRELSDYINPRGSRFLTSEVNRND---RRNTRIIDSTGTMAARTLASGMMSGI 76
gi 48696640   1 MENSKIVKRL----DFLKTDRKNVEQIWDCIRKYIMPMRSDFFSDLRSEGSinwNQNREVFDSTAGDGLETLSSSLHGSL 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696684  77 TSPATKWFELAFRDKELNSDDECRKWLENATHDVYSALQD--SNFNLEANETYIDLCGYGNAIMVEEEDEDEegSVVFQS 154
gi 45569514  78 TSPARPWFRLTTSIPELDESAAVKAWLANVTRLMLMIFAK--SNTYRALHSMYEELGAFGTASSIVLPDFDA--VVYHHS 153
gi 48697195  83 TPATQLWHRLKTGNDALNEIASVKAYLQGVVRTLFAARYRwqGGFVTQMGATYQSIGLFGPGALMIEHDVGK--GIVYRN 160
gi 30387383  77 TSPARPWFKLATPDPDMMDYGPVKIWLEVVQRRMNEVFNK--SNLYQSLPVMYASLGTFGTGAMAVMEDDQD--VIRTMP 152
gi 45580765  78 TSPARPWFRLTTSIPELDESAAVKAWLANVTRLMLMIFAK--SNTYRALHSMYEELGAFGTASSIVLPDFDA--VVYHHS 153
gi 41179382  78 TSPARPWFRLTTSIPELDESAAVKAWLANVTRLMLMIFAK--SNTYRALHSMYEELGAFGTASSIVLPDFDA--VVYHHS 153
gi 89152428  77 TSPARPWFRLATPDPEMMDYGPVKLWLEAVQNRMNDMFNK--SNLYQSLPQLYGSLGTYSTGAMAVLDDDED--IIRTMP 152
gi 48696640  77 TSPATKWFELAFRDKELNSDDECRKWLENATHDVYSALQD--SNFNLEANETYIDLCGYGNAIMVEEEDEDEegSVVFQS 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696684 155 SPIQDSYFEEDSRGQVVNFYRVFRWTPAQIYDRFGDEGTPEAIIKKAKEASNQAALkqEVVMCVFTRYDKKQNRnagtvL 234
gi 45569514 154 LTAGEYAIAADNQGRVNTLYREFQITVAQMVREFGKDKCSTTVQSLFDRGALEQWV--TVIHAIEPRADRDPSK-----R 226
gi 48697195 161 VPMQRLWFAENNSGLIDKTHVQWELTLRQAAQRFGRENLSPSMQSTLEKDPEKSAI---FYHAVEPRADRDPRK-----L 232
gi 30387383 153 FPIGSYYLANSPRGSVDTCIRQFSMTVRQMVQEFGLDNVSTSVKGMWENGTYETWV--EVNHCITPNVNRDSGK-----M 225
gi 45580765 154 LTAGEYAIAADNQGRVNTLYREFQITVAQMVREFGKDKCSTTVQSLFDRGALEQWV--TVIHAIEPRADRDPSK-----R 226
gi 41179382 154 LTAGEYAIAADNQGRVNTLYREFQITVAQMVREFGKDKCSTTVQSLFDRGALEQWV--TVIHAIEPRADRDPSK-----R 226
gi 89152428 153 FPIGSYYLANSPRGSVDTCFRKFSMTVRQLVQEFGLNNVSESVKSMWESGTYEKWI--EVMHSVYPNIDRDTSK-----L 225
gi 48696640 155 SPIQDSYFEEDSRGQVVNFYRVFRWTPAQIYDRFGDEGTPEAIIKKAKEASNQAALkqEVVMCVFTRYDKKQNRnagtvL 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696684 235 APTERPFGKKWILKEGA-VQLGEEGGYYEMPAYAIRWRKSAGSQWGFG-PSHLALPDVLTANRYVELVLRSSEKVIDPAI 312
gi 45569514 227 DDRNMAWKSVYFEPGADeTRTLRESGYRSFRALCPRWALVGGDIYGNS-PAMEALGDVRQLQHEQLRKAQAIDYKSNPPL 305
gi 48697195 233 DGRNMQFASYWLDEGRD--RIVQNSGFRTFPFAIGRFYVGTDDVYGGS-PAYDAMPDVRMANDMAKTNIRGAQKLVDPPL 309
gi 30387383 226 DSKNKPYRSVYFESGGDsDKLLRESGFDEFPILAPRWEVNGEDVYASScPGMLALGQVKALQVEQKRKAQLIDKATNPPM 305
gi 45580765 227 DDRNMAWKSVYFEPGADeTRTLRESGYRSFRALCPRWALVGGDIYGNS-PAMEALGDVRQLQHEQLRKAQAIDYKSNPPL 305
gi 41179382 227 DDRNMAWKSVYFEPGADeTRTLRESGYRSFRALCPRWALVGGDIYGNS-PAMEALGDVRQLQHEQLRKAQAIDYKSNPPL 305
gi 89152428 226 DSKNKPFKSVYYEVGGDnDKLLRESGFDEFPIMAPRWEVNGEDVYGSScPGMLALGPVKALQLLQKRKSQLIDKATNPPM 305
gi 48696640 235 APTERPFGKKWILKEGA-VQLGEEGGYYEMPAYAIRWRKSAGSQWGFG-PSHLALPDVLTANRYVELVLRSSEKVIDPAI 312
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696684 313 MVTERGLISDIDLGASGLTVVRDMES----MKPFESRARFDVSSIQLTDLRSAVRRIYYVDQLQM---KDSPAMTATEVQ 385
gi 45569514 306 QLPVSAKNQDISTVPGGLSYVDAAAPnggiRTAFEVNLDLSHLLADIVDVRERIKASFYADLFLMlanGTNPQMTATEVA 385
gi 48697195 310 LANEDGVLDGFDLRSGALNWGGLNDKgeemVKPLLTGKQAQIGIEFAQDTRQTINQWFYVTLFQIl--VDSGDMTATEVL 387
gi 30387383 306 VAPTSLKNQRVSLLPGDVTYLDVISGqdgfKPAYLVNPNTADLLADIQDTRQTINSAYFVDLFMMlqnINTRSMPVEAVI 385
gi 45580765 306 QLPVSAKNQDISTVPGGLSYVDAAAPnggiRTAFEVNLDLSHLLADIVDVRERIKASFYADLFLMlanGTNPQMTATEVA 385
gi 41179382 306 QLPVSAKNQDISTVPGGLSYVDAAAPnggiRTAFEVNLDLSHLLADIVDVRERIKASFYADLFLMlanGTNPQMTATEVA 385
gi 89152428 306 VAPTSLKNQRASLLPGDITYIDQITGqdgfRPAYLVNPSTADLVADIQDTRQIINSAYFVDLFMMlqnINTRSMPVEAVI 385
gi 48696640 313 MVTERGLISDIDLGASGLTVVRDMES----MKPFESRARFDVSSIQLTDLRSAVRRIYYVDQLQM---KDSPAMTATEVQ 385
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696684 386 VRYELMQRLLGPTLGRLENDFLSPMIQRTFNIRFRAGKLGELPSKLLEsgkAAMDIVYTGPLSRAQKIDQAASIERWAGS 465
gi 45569514 386 ERHEEKLLMLGPVLERMHNEILDPLIELTFQRMVEANILPPPPQEMQG---VDLNVEFVSMLAQAQRAIATNSVDRFVGN 462
gi 48697195 388 QRAQEKGVLLAPTLGRTQSELLGPMIAREVDILAEAGQLPDMPQELIDa-gADVDVEYDSPLNKAMRAGEGAAILQWLQQ 466
gi 30387383 386 EMKEEKLLMLGPVLERLNDEALNPLIDRVFSIMARKNMLPEPPDVLQG---MPLRIEYISVMAQAQKSIGLTSLSQTVGF 462
gi 45580765 386 ERHEEKLLMLGPVLERMHNEILDPLIELTFQRMVEANILPPPPQEMQG---VDLNVEFVSMLAQAQRAIATNSVDRFVGN 462
gi 41179382 386 ERHEEKLLMLGPVLERMHNEILDPLIELTFQRMVEANILPPPPQEMQG---VDLNVEFVSMLAQAQRAIATNSVDRFVGN 462
gi 89152428 386 EMKEEKLLMLGPVLERLNDECLNPLIDRSFSMMVRKNMLPPPPDVMEG---MPLKVEYISVMAQAQKSIGLSSLASTVNF 462
gi 48696640 386 VRYELMQRLLGPTLGRLENDFLSPMIQRTFNIRFRAGKLGELPSKLLEsgkAAMDIVYTGPLSRAQKIDQAASIERWAGS 465
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48696684 466 TAQLAEINPEVLDIPDWDEMVRMLGSLLGAPQTLMRPKAKVTSIRKNRSQTQQKAEQAAIAEAEGNAMEAQGKGQAALKE 545
gi 45569514 463 LGAVAGIKPEVLDKFDADRWADTYADMLGIDPELIVPGNQVALIRKQRADQQQAAQQAALLNQGADTAAKLGSVDTSKQN 542
gi 48697195 467 LGIVSQFDPAAAKVPNGARIARLLADYGGVPVEAMSTDEELQAQQAAEAQAAQMQQMLAAAPVAAGAIKDLSDAQTAAQT 546
gi 30387383 463 IGQLAQFKPEALDKLDVDQAIDAFSEMSGVSPTVIVPQEQVQGIREERAKQAQAAQAMAMGQAAAQGAKTLSETQTSDPS 542
gi 45580765 463 LGAVAGIKPEVLDKFDADRWADTYADMLGIDPELIVPGNQVALIRKQRADQQQAAQQAALLNQGADTAAKLGSVDTSKQN 542
gi 41179382 463 LGAVAGIKPEVLDKFDADRWADTYADMLGIDPELIVPGNQVALIRKQRADQQQAAQQAALLNQGADTAAKLGSVDTSKQN 542
gi 89152428 463 IGQLAQVKPEALDKLNVDQAIDAFADMSGVSPTVIVPQEQVEQARQQRAQQQQQQQMMAMGMAAAQGVKTLSEAKTSDPS 542
gi 48696640 466 TAQLAEINPEVLDIPDWDEMVRMLGSLLGAPQTLMRPKAKVTSIRKNRSQTQQKAEQAAIAEAEGNAMEAQGKGQAALKE 545

                ..
gi 48696684 546 NQ 547
gi 45569514 543 AL 544
gi 48697195 547 AR 548
gi 30387383 543 AL 544
gi 45580765 543 AL 544
gi 41179382 543 AL 544
gi 89152428 543 VL 544
gi 48696640 546 NQ 547
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap