Conserved Protein Domain Family
PHA00671

?
PHA00671: PHA00671 
hypothetical protein
Statistics
?
PSSM-Id: 106979
View PSSM: PHA00671
Aligned: 3 rows
Threshold Bit Score: 146.73
Threshold Setting Gi: 45569515
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45569515   1 MSGAVTAVAVGAAVGVGASMYMSNKQEKAQRSAQQQAQQQAQQQADQAKAESDRLTQEYQKQTEAYQQQAKIMQQQLLDS 80
gi 41179383   1 MSGAVTAVAVGAAVGVGASMYMSNKQEKAQRSAQQQAQQQAQQQADQAKAESDRLTQEYQKQTEAYQQQAKIMQQQLLDS 80
gi 45580766   1 MSGAVTAVAVGAAVGVGASMYMSNKQEKAQRSAQQQAQQQAQQQADQAKAESDRLTQEYQKQTEAYQQQAKIMQQQLLDS 80
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*
gi 45569515  81 QQSFNRANQKQPNSQRALSAVGSAAKSGQSGTMLTGPQGVDQSALTLGKSTLLGQ 135
gi 41179383  81 QQSFNRANQKQPNSQRALSAVGSAAKSGQSGTMLTGPQGVDQSALTLGKSTLLGQ 135
gi 45580766  81 QQSFNRANQKQPNSQRALSAVGSAAKSGQSGTMLTGPQGVDQSALTLGKSTLLGQ 135
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap