Conserved Protein Domain Family
PHA00672

?
PHA00672: PHA00672 
hypothetical protein
Statistics
?
PSSM-Id: 133920
View PSSM: PHA00672
Aligned: 4 rows
Threshold Bit Score: 85.9741
Threshold Setting Gi: 45569516
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45569516    1 MTAIVAPRPHLPAMSAEAIDRVRRLEGALAELPQVEIPTAHLFHAGVYARTIRIPAGVALTGALIKVSTV-LIFSGHATV 79
gi 41179384    1 MTAIVAPRPHLPAMSAEAIDRVRRLEGALAELPQVEIPTAHLFHAGVYARTIRIPAGVALTGALIKVSTV-LIFSGHATV 79
gi 45580767    1 MTAIVAPRPHLPAMSAEAIDRVRRLEGALAELPQVEIPTAHLFHAGVYARTIRIPAGVALTGALIKVSTV-LIFSGHATV 79
gi 160700601  11 EKSLALVKAVSVIATEERREKLNQLEGAMLQEDQVAIPVEHRFSGGIYAREITIPKGTLLTGRIHKFDHFdIMLSGDITV 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45569516   80 FIG-GEAVELRGYHVIPASAGRKQAFVAHADTDLTMLFPSEARS----------------------VAEAEAEFTDEADL 136
gi 41179384   80 FIG-GEAVELRGYHVIPASAGRKQAFVAHADTDLTMLFPSEARS----------------------VAEAEAEFTDEADL 136
gi 45580767   80 FIG-GEAVELRGYHVIPASAGRKQAFVAHADTDLTMLFPSEARS----------------------VAEAEAEFTDEADL 136
gi 160700601  91 STDtGEVKRLTGLNIMEGKAGKKRAGYAHEDTHWITFHCAEERNpeemyefltcgsfqeleefnvmLENAMAQIEHDEQV 170
                        170
                 ....*....|....*.
gi 45569516  137 LLSHQQGAETITFTGE 152
gi 41179384  137 LLSHQQGAETITFTGE 152
gi 45580767  137 LLSHQQGAETITFTGE 152
gi 160700601 171 LAEH---AKAICSKGE 183
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap