Conserved Protein Domain Family
PHA00675

?
PHA00675: PHA00675 
hypothetical protein
Statistics
?
PSSM-Id: 106982
View PSSM: PHA00675
Aligned: 3 rows
Threshold Bit Score: 147.967
Threshold Setting Gi: 45580771
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45580771  1 MLKTVAVNDAGLRVGEDHPNAKLTDAEVERIRELHEVEGMSYAVLAEKFEQSKGAIAKICRYERRGQFAVRVKTVPVR 78 
41179388  1 MLKTVAVNDAGLRVGEDHPNAKLTDAEVERIRELHEVEGMSYAVLAEKFEQSKGAIAKICRYERRGQFAVRVKTVPVR 78 
45569520  1 MLKTVAVNDAGLRVGEDHPNAKLTDAEVERIRELHEVEGMSYAVLAEKFEQSKGAIAKICRYERRGQFAVRVKTVPVR 78 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap