Conserved Protein Domain Family
PHA00679

?
PHA00679: PHA00679 
hypothetical protein
Statistics
?
PSSM-Id: 106984
View PSSM: PHA00679
Aligned: 3 rows
Threshold Bit Score: 93.2123
Threshold Setting Gi: 45580777
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 45580777  1 MMIYYLTYLAAGVLLGLAVLPWKQRLGSREGVLLWLLAWACFWPYLLLYAAWQGLKAYRAAWWAYTGHKHQ 71
gi 41179393  1 MMIYYLTYLAAGVLLGLAVLPWKQRLGSREGVLLWLLAWACFWPYLLLYAAWQGLKAYRAAWWAYTGHKHQ 71
gi 45569526  1 MMIYYLTYLAAGVLLGLAVLPWKQRLGSREGVLLWLLAWACFWPYLLLYAAWQGLKAYRAAWWAYTGHKHQ 71
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap