Conserved Protein Domain Family
PHA00687

?
PHA00687: PHA00687 
hypothetical protein
Statistics
?
PSSM-Id: 106987
View PSSM: PHA00687
Aligned: 3 rows
Threshold Bit Score: 77.6302
Threshold Setting Gi: 45580783
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....*.
gi 45580783  1 MKNRQPVQTTLPPEAMRLLQQAAQTPITRADPLARVKAIEKATERVKRQYPHFFKE 56
gi 45569532  1 MKNRQPVQTTLPPEAMRLLQQAAQTPITRADPLARVKAIEKATERVKRQYPHFFKE 56
gi 41179399  1 MKNRQPVQTTLPPEAMRLLQQAAQTPITRADPLARVKAIEKATERVKRQYPHFFKE 56
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap