Conserved Protein Domain Family
PHA00689

?
PHA00689: PHA00689 
hypothetical protein
Statistics
?
PSSM-Id: 106988
View PSSM: PHA00689
Aligned: 3 rows
Threshold Bit Score: 122.463
Threshold Setting Gi: 41179401
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 41179401  1 MTYFDEYDQDHDQEPRAVTCKRCGKTGLRWEDDGGEWVLMEGHYKIHRCDMRKAALDDFEAV 62
gi 45580785  1 MTYFDEYDQDHDQEPRAVTCKRCGKTGLRWEDDGGEWVLMEGHYKIHRCDMRKAALDDFEAV 62
gi 45569534  1 MTYFDEYDQDHDQEPRAVTCKRCGKTGLRWEDDGGEWVLMEGHYKIHRCDMRKAALDDFEAV 62
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap