Conserved Protein Domain Family
PHA00780

?
PHA00780: PHA00780 
hypothetical protein
Statistics
?
PSSM-Id: 107010
View PSSM: PHA00780
Aligned: 8 rows
Threshold Bit Score: 108.171
Threshold Setting Gi: 46358693
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46358693    1 MAEITALTELQQMNLDILRLVQSDTAAAEKAIAFVAGSKLNFELFKDQLVLAQGEGTALARAEKAIREAKEALDLFTAGA 80
gi 41057340    1 MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITTRTIEAVRKSKEALDLFTTGA 80
gi 13559863    1 MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITTRTIEAVRKSKEALDLFTTGA 80
gi 9635552     1 MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITTRTIEAVRKSREALDLFTTGA 80
gi 24371580   39 MAEITALTELQQMNLDILRLVQSDTAAAEKAIAFVAGSKLNFELFKDQLVLAQGEGTALARAEKAIREAKEALDLFTAGA 118
gi 219681239  39 MAEITALTELQQMNLDILRLVQSDTAAAEKAIAFVAGSKLNFELFKDQLVLAQGEGTALARAEKAIREAKEALDLFTAGA 118
gi 221328688   1 MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITTRTIEAVRKSKEALDLFTTGA 80
gi 255252748   1 MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITTRTIEAVRKSKEALDLFTTGA 80
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap