Conserved Protein Domain Family
PHA01076

?
PHA01076: PHA01076 
putative encapsidation protein
Statistics
?
PSSM-Id: 107017
View PSSM: PHA01076
Aligned: 5 rows
Threshold Bit Score: 568.859
Threshold Setting Gi: 157738595
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29565730    1 MNDDIDYYISISNRSDGKSFNYVSFFIYLAIKLDIKFTLLSRHYTLRDAYRDFIEEIIDENPLFKSKRVTFRSARDYLAI 80
gi 31072014   46 CSDEILHYMSITSRGDGKSFNYIGALAWLSYHLNFGTMLLVRHWSLMDKMAEMVFEIIRTVGMFDIENVGIQAKADYLTI 125
gi 66395192   38 MNDDIDYYISISNRSDGKSFNYVSFFIYLAIKLDIKFTLLSRHYTLRDAYRDFIEEIIDENPLFKSKRVTFRSARDYLAI 117
gi 29565752    1 MNDDIDYYISISNRSDGKSFNYVSFFIYLAIKLDIKFTLLSRHYTLRDAYRDFIEEIIDENPLFKSKRVTFRSARDYLAI 80
gi 157738595   1 MNDDIDYYISISNRSDGKSFNYVSFFIYLAIKLDIKFTLLSRHYTLRDAYRDFIEEIIDKNPLFKSKRVTFRSARDYLAI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29565730   81 IYQDKEIGVITDLNSATDLKYHSNFLKHYPIIIYDEFLALEDDYLIDEWDKLKTIYESIDRnHGNVDYIGFPKMFLLGNA 160
gi 31072014  126 TIEGREVFIITNLNNASDLKQSSAVLRNYPVVLYDEFLTLGEDYVTNELAKLQTIIKSIDR-MGKRPYIKRPKIIYLGNP 204
gi 66395192  118 IYQDKEIGVITDLNSATDLKYHSNFLKHYPIIIYDEFLALEDDYLIDEWDKLKTIYESIDRnHGNVDYIGFPKMFLLGNA 197
gi 29565752   81 IYQDKEIGVITDLNSATDLKYHSNFLKHYPIIIYDEFLALEDDYLIDEWDKLKTIYESIDRnHGNVDYIGFPKMFLLGNA 160
gi 157738595  81 IYQDKEIGVITDLNSATDLKYHSNFLKHYPIIIYDEFLALEDDYLIDEWDKLKTIYESIDRnHGNVDYIGFPKMFLLGNA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29565730  161 VNFSSPILSNLNIYNLLQKHKMNTSRLYKNIFLEMRRNDYVNEKRNTRAFNSNDDAMTTGEFEFNEYNLADDNLRNHINQ 240
gi 31072014  205 VNFDSPILPALNIFYALQNQEINTIQQHGKTILELRRNDEVNEEKTTGYFEDSVDSDITGEFNFSNYRLADQQTYNKALT 284
gi 66395192  198 VNFSSPILSNLNIYNLLQKHKMNTSRLYKNIFLEMRRNDYVNEKRNTRAFNSNDDAMTTGEFEFNEYNLADDNLRNHINQ 277
gi 29565752  161 VNFSSPILSNLNIYNLLQKHKMNTSRLYKNIFLEMRRNDYVNEKRNTRAFNSNDDAMTTGEFEFNEYNLADDNLRNHINQ 240
gi 157738595 161 VNFSSPILSNLNIYNLLQKHKMNTSRLYKNIFLEMRRNDYVNERRNTRAFNSNDDAMTTGEFEFNEYNLADDNLRNHINQ 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29565730  241 NGDFFYIKTDDKYIKVMYNVTTfmTNIIVVPYTK-QYEFCTKIRDIDNHVTYLRDDMFYKENMERyyYNPSNLHFDNAYS 319
gi 31072014  285 NGTLYKIRLEDKLSYVILESDN--EYILSIEESKlDENYCIHLKDETATCEYLKPSFYKDSFIKR--FQKGHFNFKDSFS 360
gi 66395192  278 NGDFFYIKTDDKYIKVMYNVTTfmTNIIVVPYTK-QYEFCTKIRDIDNHVTYLRDDMFYKENMERyyYNPSNLHFDNAYS 356
gi 29565752  241 NGDFFYIKTDDKYIKVMYNVTTfmTNIIVVPYTK-QYEFCTKIRDIDNHVTYLRDDMFYKENMERyyYNPSNLHFDNAYS 319
gi 157738595 241 NGDFFYIKTDDKYIKIMYNVDTfnANIIVIPYTK-QYEFCTKIKDIDDNVIYLREDMFYKENMERyyYNPSNLHFDNAYS 319
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 29565730  320 KNYVVDNDRYLYLDMNKIikfhiknemkkNMSEFERKEKIYEDNYIENTKKYLMKQYGL 378
gi 31072014  361 RTFIEGNEDLQRLNFFKL-----------NAVASTDHEDAYANIVRESWISRLAKIYEQ 408
gi 66395192  357 KNYVVDNDRYLYLDMNKIikfhiknemkkNMSEFERKEKIYEDNYIENTKKYLMKQYGL 415
gi 29565752  320 KNYVVDNDRYLYLDMNKIikfhiknemkkNMSEFERKEKIYEDNYIENTKKYLMKQYGL 378
gi 157738595 320 KNYVVDNDRYLYLDMNKIikfhiknemkkNINEFERKEKIYEDNYIENTKKYLMKQYGL 378
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap