Conserved Protein Domain Family
PHA01159

?
PHA01159: PHA01159 
hypothetical protein
Statistics
?
PSSM-Id: 107025
View PSSM: PHA01159
Aligned: 4 rows
Threshold Bit Score: 150.734
Threshold Setting Gi: 9635483
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625372    1 MEWLSGFLDQIIAFFQWIWDFFAQGIyDFVRDGLVVATKASMYAALQTLILLIDVSYTAARELIDSLGVPQMIRSMYAAL 80
gi 52221129   1 MQFLLDLLGAIANAGDTVTEFFKSIP-DYFGQLVVWGNAWYVKLKFLWLIYSLELAYKTAEYLLNDIGFNDMLASFFNAL 79
gi 9635483    1 MEYIYSALEFIANIGQTFLDFFDVAI-EWIKNAFEYGAMWLISVWLDIKIASIQIALKIAQLLLEEYGVYTLVEDRFNAL 79
gi 9635472    1 MEYIYSALEFIANIGQTFLDFFDVAI-EWIKNAFEYGAMWLISVWLDIKIASIQIALKIAQLLLEEYGVYTLVEDRFNAL 79
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 9625372   81 PGPIAAGLAFFGVPQALNIIMGRGGDALLhaLRAVHW 117
gi 52221129  80 PDEIRYYAFIFKIPQAIGIYFNCLATAFV--WKITRF 114
gi 9635483   80 PSDVRYILTEYGVTSGLRVIFDAFATSLV--MRFFNW 114
gi 9635472   80 PSDVRYILTEYGVTSGLRVIFDAFATSLV--MRFFNW 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap