Conserved Protein Domain Family
PHA01351

?
PHA01351: PHA01351 
putative minor structural protein
Statistics
?
PSSM-Id: 107029
View PSSM: PHA01351
Aligned: 3 rows
Threshold Bit Score: 1695.52
Threshold Setting Gi: 159341086
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311     1 MFIILKRNILINMSFLVNLGELGTFFADEIENLENFTNWISSDFINFINAIVNDIKNIASFLGQAISDIPTFMTNIATNF 80
gi 22122257     1 MFIILKRNILINMSFLLNLGELGTFFADEIENLENFTNWISSDFINFINAIVNDIKNIASFLGQAISDIPTFMVNIATNF 80
gi 159341086    1 -----------MSGLIGDLTSLGTFFSDELGALENFVDFLATDFETFINSIASDFETFISYIATAVSDLATFAQTVYNDI 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311    81 LTILQNFVQTAISTIQGFVSWFEQQVVGAFEFLSSIASDFINSAYSFFQNVANAFAQIISGVISDFLNFFGANMKHIANA 160
gi 22122257    81 LTILQNFVQTAISTIQGFVSWFEQQIVGAFEFLSSIASDFINSAYSFFQNVANVFAQIISGVISDFLNFFGANMKHISNA 160
gi 159341086   70 VSALQNIASAIYPVLRNIGGIIAGAIETALGDLAQFAIDATGALANAIRTITNDIGSLLGTFISDAFQALGNIPLHISPF 149
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   161 ISQLTQFLSPFIAPITIGKFLPVIVDKLAEILPEVEIDLAPVGLGGKIPIKFGEIIKAFAETSVDFLNEIRIELATTLKE 240
gi 22122257   161 ISQLSQFLSPFIAPITIGKFLPVIVDKLAEILPEIEIDLAPVGLGGKIPIKFGEIIKAFAETSVDFLNEIRTELATTLKE 240
gi 159341086  150 LAKASTFLASVISPYLIIRALPPAIDKLAELLPDFTISLAPVGLGARFEVKLGEIVKMFGENAADFMKDVSDEMMSTFKE 229
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   241 FIKEPFISDFKISAREIFNEIGLGDLPFADPPFQLIGRWVAVRSFEEVKDHLKETILLTGYPAWFTDAYLESPTNDFLPR 320
gi 22122257   241 FIKEPFISDFKISAREIFNEIGLGDLPFADPPFQLIGRWVAVRSFDEVKDHLRETILLTGYPAWFTNAYLESPVNDFVPK 320
gi 159341086  230 FIKEPFISNFKIQVREIFNDIGLGDIPFADPSFTQIAKWVGARSFNEIKDHLKETVLLTGYAQWFTDAYLQPPVNDFVPQ 309
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   321 NPLFRPVGIRDLILGTQYGILNISDLEKYAYNNLITPKTAKLMYQNQTARLLQRTVEQGIRQFIVTPQKAYEEIIQNINL 400
gi 22122257   321 NPLFRPVGIRDLITGSQYGILNISDLEKYAYNNLITPKTAKLMYQNQTARLLQRAVEQGIRQFVITPQKAYEEIISNINL 400
gi 159341086  310 NPLFKPVAIKDVITAVEYGILPADAVGKYAENNLITQKTATLMYQNQNLKLFQRVVEQGIRAFVVEPDKAYQLMTSGVSL 389
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   401 TGKELFLKTFTLEYEYAVQRIVRQFLRSLLSRALSNFGRPYLDFKYLDDTIAKLFKDLGYPEEVRTVFDTMITQSQLIYT 480
gi 22122257   401 TGKELFLKTFTLEYEYAVQRIVRQFLRSLLSRALSNFGKPYLDFKYLDNTIAKLFKDLGYPEEVRTVFDTMITQSQLIDT 480
gi 159341086  390 SGRDLFTKYFDIEYQFATQRFAKQVLRSLLSRALSNFGRPYIDIQYLSSTTSKIFKELNLPTAIDNLFKEMMSQSQLIQY 469
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   481 NQLLLRQLQQIVRLGIFDQKKIKEELKANKFNEQVALQILESELQFAQLQNILKEYQFKLRNFLISPRDLEKDLKHIGFD 560
gi 22122257   481 NQLLLRQLQQIVKLGIFNEKKIKEELKANKFNEQVALQILESELQFAQLQNTLKEYQFKLKSFLISPKDVEKDLKHLGFD 560
gi 159341086  470 NQLIYGLLRSEASMGIFDQQKVNELLQSHNFNVAETEYLLAHYANIAVMKEQLSVLKAKANNFFISDQDLGKELTSLGFT 549
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   561 SAIISALIYENQVEQLIKFQLSNIESLAKKGYLSLDEIKKQFKAIGIIKEYEDAFINFVNQELQISAFLTILKSQLRQFQ 640
gi 22122257   561 SAIISALIYENQVEQLIKFQLTNIESLAKKGYLSLDEIKKQFKAIGIIKEYEDAFINFINQELQISAFLTILKSQLRQFQ 640
gi 159341086  550 PEYIQAFAEENFTLPLRKEIANVYLSLLRKGYYDVKEAKSIFGGLGYEKSVIEQLTNVYSTEIETELAIKTIQQKAQLFL 629
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   641 IDPKIAEVELKKLNINEYLLNQIIQEEYNINIAKLQLSVLETIAKTLYYDQQQ--------------------------- 693
gi 22122257   641 IDPKVAEAELKKLNINEYLSNQIIQEEYNINIAKLHLSVLETIAKTLYYDQQQ--------------------------- 693
gi 159341086  630 LSQQEIITELKKLQVSDALANEITVEYFAIPLLKQQISVYESLIKKGYLNTDDakkvftslgyrqsvvdqliplyateit 709
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   694 ---------------------LSGELGKIVKDKTALDLYIQKFYYEYIYPKIINYHLQLARHGILS-------------D 739
gi 22122257   694 ---------------------LSGELEKIIKDKTALELYIKKFYYEYIYPKIVNYHVQLARHGILS-------------D 739
gi 159341086  710 adatiakyksllqhfavnvktAEQELKQLHISSSLIEQILTEYYQVPLIEKLSAIYLSMLEKGYITidvlkkvlgpqniD 789
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   740 ISKLPKEVVDYELKPAILTYQTTLEIEYIKESLKDLEIKPDNAINELEKLGMQKDIAQLIVNTYIPTFYSIHTIIQNIIE 819
gi 22122257   740 ISKLPKEVIDYEIKPALLTYQTTLEIEYIKESLKDLEIKPTDAINELEKLGMQKDIAQLIVNTYIPTFYNVHTIIQNIIE 819
gi 159341086  790 VSAITEIANAYNYEITVAN-----EIKYVQSLLRNLLIDEKTAEQELKKLNVSDSLVKAIVAESTPVVVSPKTVAQTLIE 864
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   820 GQLYKIGKVPINLGNAESELRKLGIPDSQIKVLLEQYASTFGLEIWRRHLPSLSIIENAIKYNYLDQKLIEYSFIPSELL 899
gi 22122257   820 GQLYKVGKVPINLGNAESELRKLGIPDSQIKILLDQYSTTFGLDIWRKHLPSISIIENAIKYNYLDQKLIEYSFIPSELL 899
gi 159341086  865 GAIYHIQKVPVSVSHVIGELKKLNIPDSQVNALIDEIESQIALDIWKKYLPTLSDIESALTYGYPTEKLVQLSLIPAELL 944
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   900 NLYTSYYQHLLVAQEVQSFKSEYITALIYNYQNLQLESLLKQYGINEALLNVMKLFAQVRKVVTGLQELYLTPSKALSIS 979
gi 22122257   900 NLYINYYQHLLVGQEVQSFKSEYITALIYNYQNLQLENLLKQYGINEALLSVIKLFAQVRKIVLGLQELYLTPTKALSIS 979
gi 159341086  945 NIHVNLTQHEMVGKEVQSLKSAYVKLLTYGIANAQLESLMRQYGVNDQLLSVLRLQAQLEKILTTYQELYLTPSKAISLS 1024
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122311   980 EYVSNPQQLLQKVFSEFQIPQELQNTYFEYARNRRVSRYVNEIITTINLLFEKQKIDLNTAQSYLQQLKKYGLTDEEIQL 1059
gi 22122257   980 EYVSNPQQLLQKVFTEFQIPQELQNTYFEYARNRRVSRYVNEIITTINLLFEKHKIDLGTAQSYLQQLKKYGLTDEEIQL 1059
gi 159341086 1025 EYLSNPTQTLQKVFADYQVPSDLQQIYMEYTRNRRLRTYISQIVETISLLFERHKITLDQAVQYLQQFKQYGLTDEEIQL 1104
                        1130
                  ....*....|.
gi 22122311  1060 ITLNWQLRSAY 1070
gi 22122257  1060 IILNWQLRSAY 1070
gi 159341086 1105 IKLNWQLREMY 1115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap