Conserved Protein Domain Family
PHA01365

?
PHA01365: PHA01365 
hypothetical protein
Statistics
?
PSSM-Id: 107030
View PSSM: PHA01365
Aligned: 3 rows
Threshold Bit Score: 138.046
Threshold Setting Gi: 9625549
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625549    8 ITYGREAIERIICKYFKDSKIEKILFLPSEEDVKAKYIIgrvgFIRISNTWSGIVVVDGVQIPFVAEVHLNGKIDIYLYP 87 
22122295   1 MTDYKNGIKKLLQKCFPGRSIDVIFMSCNNLSPHKNYMV----IDPEIKYYIGYILTSGIKIPFIAEIWHNNTTRIYLDP 76 
22122242   1 MTDYKNGIKKLLQKCFSDKSIDVIFMSCNNLSPHKDYMI----IDPETKYYIGYILTNGIKIPFIAEVWHNNTTRIYLDP 76 
9625549   88 QKDFYLAHLVGELNG 102
22122295  77 RKDFYLALLLGDLNV 91 
22122242  77 RKNFYLALFIGDLNV 91 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap