Conserved Protein Domain Family
PHA01486

?
PHA01486: PHA01486 
nonstructural protein
Statistics
?
PSSM-Id: 107034
View PSSM: PHA01486
Aligned: 3 rows
Threshold Bit Score: 33.834
Threshold Setting Gi: 77020117
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30
               ....*....|....*....|....*....|..
gi 9634950   1 MTKSLDIRRDLRSIAIRLRKLPASSDQMLQVL 32
gi 47566142  1 MSKSLDIRRDLRSIAIRLRKLPASSDQMLQVL 32
gi 77020117  1 MSKSLDIRRDLRSIAIRLRKLLASSDQMLQVL 32
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap