Conserved Protein Domain Family
PHA01511

?
PHA01511: PHA01511 
coat protein
Statistics
?
PSSM-Id: 107035
View PSSM: PHA01511
Aligned: 6 rows
Threshold Bit Score: 851.366
Threshold Setting Gi: 219681246
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9635538     1 MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80
gi 46358700    1 MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80
gi 24371587    1 MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80
gi 219681246   1 MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80
gi 221328623   1 MALNEGQIVTLAVDEIIDTISAITPMAQKAKKYTPPASSMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80
gi 255252687   1 MALNEGQIVTLAVDEIIDTISAITPMAQKAKKYTPPASSMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9635538    81 EPDNDFFQLRADDLRDETAYRRRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEEIMFSREL 160
gi 46358700   81 EPDNDFFQLRADDLRDETAYRHRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEELMFSREL 160
gi 24371587   81 EPDNDFFQLRADDLRDETAYRHRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEELMFSREL 160
gi 219681246  81 EPDNDFFQLRADDLRDETAYRHRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEELMFSREL 160
gi 221328623  81 EPDNDFFQLRADDLRDETAYRHRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEELMFSREL 160
gi 255252687  81 EPDNDFFQLRADDLRDETAYRHRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEELMFSREL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9635538   161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
gi 46358700  161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
gi 24371587  161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
gi 219681246 161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
gi 221328623 161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
gi 255252687 161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9635538   241 WQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
gi 46358700  241 WQLDNDGNKVNVDNRFATVTLSATTGLKRGDKISFTGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
gi 24371587  241 WQLDNDGNKVNVDNRFATVTLSATTGLKRGDKISFTGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
gi 219681246 241 WQLDNDGNKVNVDNRFATVTLSATTGLKRGDKISFTGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
gi 221328623 241 WQLDNDGNKVNIDNRFATVTLSATTGLKRGDKISFTGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
gi 255252687 241 WQLDNDGNKVNIDNRFATVTLSATTGLKRGDKISFTGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9635538   321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIST 400
gi 46358700  321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIST 400
gi 24371587  321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIST 400
gi 219681246 321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFRTQGDIST 400
gi 221328623 321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIST 400
gi 255252687 321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIST 400
                        410       420       430
                 ....*....|....*....|....*....|
gi 9635538   401 LSGLCRIALWYGVNATRPEAIGVGLPGQTA 430
gi 46358700  401 LSGLCRIALWYGVNATRPEAIGVGLPGQTA 430
gi 24371587  401 LSGLCRIALWYGVNATRPEAIGVGLPGQTA 430
gi 219681246 401 LFRLCRIALWYGVNATRPEAIGVGLPGQTA 430
gi 221328623 401 LSGLCRIALWYGVNATRPEAIGVGLPGQTA 430
gi 255252687 401 LSGLCRIALWYGVNATRPEAIGVGLPGQTA 430
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap