Conserved Protein Domain Family
PHA01514

?
PHA01514: PHA01514 
O-antigen conversion protein C
Statistics
?
PSSM-Id: 107037
View PSSM: PHA01514
Aligned: 3 rows
Threshold Bit Score: 810.361
Threshold Setting Gi: 24371535
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24371535   1 MKFNSNDRIFISIFLGLAIIYTFPLLTHQSFFVDDLGRSLYGGLGWSGNGRPLSDFIFYIINFGTPIIDASPLPLMLGIV 80
gi 51236725   2 VKFNSNDRIFISIFLGLAIIYTFPLLTHQSFFVDDLGRSLYGGLGWSGNGRPLSDFIFYIINFGTPIIDASPLPLMLGIV 81
gi 46358649   1 MKFNSNDRIFISIFLGLAIIYTFPLLTHQSFFVDDLGRSLYGGLGWSGNGRPLSDFIFYIINFGTPIIDASPLPLMLGIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24371535  81 ILALALSCIREKLFGDDYITASLCFMMILANPFFIENLSYRYDSLTMCMSVAISIISSYVAYQYKPINIIISSILTIAFL 160
gi 51236725  82 ILALALSCIREKLFGDDYITASLCFMMILANPFFIENLSYRYDSLTMCMSVAISIISSYVAYQYKPINIIISSILTIAFL 161
gi 46358649  81 ILALALSCIREKLFGDDYITASLCFMMILANPFFIENLSYRYDSLTMCMSVAISIISSYVAYQYKPINIIISSILTIAFL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24371535 161 SLYQAALNTYAIFLLAFIISDVVKKNSISNITKNTASSVAGLIVGYFAYSYFIAKRLVTGSYNIEHSKIIEINSSLFEGI 240
gi 51236725 162 SLYQAALNTYAIFLLAFIISDVVKKNSISNITKNTASSVAGLIVGYFAYSYFIAKRLVTGSYNIEHSKIIEINSSLFEGI 241
gi 46358649 161 SLYQAALNTYAIFLLAFIISDVVKKNSISNITKNTASSVAGLIVGYFAYSYFIAKRLVTGSYNIEHSKIIEINSSLFEGI 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24371535 241 ISNVLSFYRMFSTILNGDNYLIYYSLFFALIISLIVIVLKVIKRDENKKTKFLLVVLILLASMFFIIGPMIFLKSPIYAP 320
gi 51236725 242 ISNVLSFYRMFSTILNGDNYLIYYSLFFALIISLIVIVLKAIKRDENKKTKLLLVVLILLASMFFIIGPMIFLKSPIYAP 321
gi 46358649 241 ISNVLSFYRMFSTILNGDNYLIYYSLFFALIISLIVIVLKVIKRDENKKTKFLLVVLILLASMFFIIGPMIFLKSPIYAP 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24371535 321 RVLIGMGGFMFFCCLCVFYAFEDKQLISRIYFSFILLISTIFSYGAYNAINAQFQLEESIVNRISQDIDHLGFGRDKKNI 400
gi 51236725 322 RVLIGMGGFMFFCCLCVFYAFEDKQLISRIYFSFILLISTIFSYGAYNAINAQFQLEESIVNRISQDIDYLGFGRDKKNI 401
gi 46358649 321 RVLIGMGGFMFFCCLCVFYAFEDKQLISRIYFSFILLISTIFSYGAYNAINAQFQLEESIVNRISQDIDHLGFGRDKKNI 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24371535 401 KFIGTEPYASINENIVIKHPLMRELIPRIINNNWMWSEVLMQRNVFSRNYRLYDKEVKLENGWKKSGNNVYDIGVVGETI 480
gi 51236725 402 KFIGTEPYAPINENIVIKHPLMRELIPRIINNDWMWSEVLMQRNVFSRNYRLYDKEVKLENGWKKSGNNVYDIGVVGETI 481
gi 46358649 401 KFIGTEPYASINENIVIKHPLMRELIPRIINNNWMWSEVLMQRNVFSRNYRLYDKEVKLENGWKKSGNNVYDIGVVGETI 480

                ....*
gi 24371535 481 VVRFN 485
gi 51236725 482 VVRFN 486
gi 46358649 481 VVRFN 485
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap