Conserved Protein Domain Family
PHA01516

?
PHA01516: PHA01516 
hypothetical protein
Statistics
?
PSSM-Id: 107038
View PSSM: PHA01516
Aligned: 4 rows
Threshold Bit Score: 186.322
Threshold Setting Gi: 119952195
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119952195   5 NRLRVWHIPQVPGKAFYVEVDSVEEGVRIIDILANYDLFQYENNIKGDYCNVSGLQMYDEHITDDEMEEMGLTDRWVDWY 84
gi 46358664    1 MKLRVWHIPQVPMKPFIVEVASVEEGVRVMDALADYDAFQYDNNIKPDYCNANGLEMWDESLTDQDLEEMELTDRWVDWY 80
gi 24371553    1 MKLRVWHIPQVPMKPFIVEVASVEEGVRVMDALADYDAFQYDNNIKPDYCNANGLEMWDESLTDQDLEEMELTDRWVDWY 80
gi 9635509     1 MKLRVWHIPQVPMKPFIVEVGSVEEGVRMMDALADYDAFQYDNNIKPDYCNANGLQMFDESLTDQDLEDMELDDRWIDWY 80
                         90       100
                 ....*....|....*....|
gi 119952195  85 yeDDQNFFDNPKEYLNNLKK 104
gi 46358664   81 --SECQCYDDPREYIESLKE 98
gi 24371553   81 --SECQCYDDPREYIESLKE 98
gi 9635509    81 --SECQCYDDPREYLESLKE 98
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap