Conserved Protein Domain Family
PHA01519

?
PHA01519: PHA01519 
hypothetical protein
Statistics
?
PSSM-Id: 107039
View PSSM: PHA01519
Aligned: 4 rows
Threshold Bit Score: 150.033
Threshold Setting Gi: 46358681
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46358681    1 MTMDYSQLSDFEINRMV----GDIIFKGLwackpetsgnntnKWYYGNADTTFEPLNHLP------DYCNDPSASWPIIE 70
gi 9635524     1 MTMDYSQLSDFEINKRVaiatGHKKFNGL-------------GWQGTQEDSCSAVIVRGPtkigafDPCNNPADAWPIIE 67
gi 24371569    1 MTMDYSQLSDFEINRMV----GDIIFKGLwackpetsgnntnKWYYGNADTTFEPLNHLP------DYCNDPSASWPIIE 70
gi 219681228   1 MTMDYSQLSDFEINRMV----GDIIFKGLwackpetsgnntnKWYYGNADTTFEPLNHLP------DYCNDPSASWPIIE 70
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 46358681   71 KHRISILDQLTEWCVDAKGVSPIFDTRPLRAAMIVFLMMQDANNA 115
gi 9635524    68 KYRISFLDQLTEWCVDAKGVSPIFDIRPLRAAMIVFLLMQDANNA 112
gi 24371569   71 KHRISILDQLTEWCVDAKGVSPIFDTRPLRAAMIVFLMMQDANNA 115
gi 219681228  71 KHRISILDQLTEWCVDAKGVSPIFDTRPLRAAMIVFLMMQDANNA 115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap